General Catalogue 14/15

General Catalogue 14/15
9/1
General Catalogue
Catálogo General
“This catalogue replaces the previous ones.
Data into this catalogue are subject to change
without prior notice for the purpose of improvement or
discontinued products. We kindly request you to ask
VJG NCVGUV URGEKſECVKQPU CPF EJGEM VJG EQPVGPVU KP VJG
moment of placing an order.
;QWECPſPFCPFWRFCVGFXGTUKQPQHQWTECVCNQIWGCVQWT
website”.
www.elt.es
“El presente catálogo anula y sustituye los anteriores.
Los datos de este catálogo están sujeto a cambios
sin previo aviso por cuestiones de mejora o de
descatalogación de producto. Les rogamos se aseguren
de utilizar la documentación más actualizada y revisar
sus contenidos en el momento de realizar pedidos.
En nuestra página Web puede encontrar una versión
actualizada de nuestros productos”
www.elt.es
GENERAL INDEX
ÍNDICE GENERAL
Control gears for LED
Equipos de alimentación para LED
Accessories
Accesorios
7
87
93
Ballasts and control gears for HiD lamps
Reactancias y Equipos para lámparas de HiD
167
Transformers for very low voltage halogen lamps
Transformadores para lámparas halógenas
de Muy baja Tensión
255
GENERAL INFORMATION
Additional information for all ranges
INFORMACIÓN GENERAL
Información complementaria de todas las gamas
267
Guarantee
Garantía
275
Packaging
Empaquetado
277
Sales network
Red comercial
291
Index of product name
Índice de producto
293
Introduction
Introducción
ELT - Especialidades Luminotécnicas S.A. is a Zaragozabased company that designs, manufactures and sells lighting
equipment for the professional lighting sector. Its product portfolio
is made up of the following families:
ELT - Especialidades Luminotécnicas S.A. es una
empresa con sede en Zaragoza, que ofrece diseño, fabricación y
venta de equipos de alimentación para el sector profesional de la
iluminación y el alumbrado. La cartera de productos está formada
por las siguientes familias:
~ Control gears for LED modules
~ LED modules
~ Fuentes de alimentación para módulos LED
~ Electronic and electromagnetic ballasts for fluorescent and
high-intensity discharge lamps (HPS, MH and MV)
~ Módulos LED
~ Balastos electrónicos y reactancias electromagnéticas para
lámparas fluorescentes y de alta intensidad de descarga (VSAP,
HM y VM).
~ Electronic and electromagnetic transformers for halogen lamps.
~Transformadores electrónicos y electromagnéticos para lámparas halógenas.
ELT is the only Spanish company that designs and manufactures
a whole range of both magnetic and electronic power equipment for
currently existing light sources (LED, fluorescent, HID and halogen
ones).
Se trata de la única empresa española que diseña y fabrica toda
la gama de equipos de alimentación, tanto magnéticos como electrónicos, para las fuentes de luz actualmente existentes (LED, fluorescentes, HID y halógenas).
Over the last three years ELT has improved its production
capacity by means of automating its processes and strongly
committing to R&D&I, which has led to developing new, innovative
and competitive products. That’s why the 2014 edition of the
En los últimos 3 años, ELT ha mejorado su capacidad productiva
mediante la automatización de procesos y ha apostado fuertemente
por el área de I+D+i, lo que se ha traducido en el desarrollo de
nuevos productos innovadores y competitivos. Es por ello que en
catalogue contains the following novelties:
esta edición del catálogo 2014, se incorporan las siguientes
novedades:
~ Highly luminous efficient eLED LINE modules; LED technology
based lighting to work at low voltages thus achieving low
heating rates
~ Módulos eLED LINE de alta eficiencia lumínica; iluminación
basada en tecnología LED para trabajar a tensiones bajas y
obtener bajos calentamientos
~ Constant current LC drivers to complement the eLED LINE
modules. Available in 10, 16, 25, 60 or 90W versions and
different formats.
~ Drivers LC para complementar los módulos eLED LINE para
corriente constante. Disponibles en versiones 10, 16, 25, 60 o
90W en diferentes formatos.
~ HID. Electronic ballasts for IP20 rated 20 to 150W discharge
lamps (MH)
~ HID. Balastos electrónicos para lámparas de descarga (HM) de
20 a 150W en IP20
~ BE-MH-SMI. Electronic ballasts with power control for
discharge lamps (HPS and MH). OUTDOOR applications
~ BE-MH-SMI. Balastos electrónicos con regulación para
lámparas de descarga (VSAP y HM). Aplicaciones OUTDOOR
~ FLUO DALI. Dimmable electronic ballasts for T5, T8 and TCL
fluorescent lamps.
~ FLUO DALI. Balastos electrónicos con regulación DALI para
lámparas fluorescentes T5, T8 y compactas.
For further information about products development and
novelties please visit the following link:
Para obtener más información sobre los desarrollos de producto y
novedades consultar la siguiente URL:
http://www.elt.es/novedades/i-novedades.html.
http://www.elt.es/novedades/novedades.html.
ELT has decided to extend its standard product warranty
to 5 years as of 2014. See the conditions page 275 for further
Siguiendo con la política de mejora de producto y de servicio, ELT
ha decidido ampliar la garantía estándar de sus productos a
5 años a partir de 2014. Para obtener más información, consultar la
information.
página 275 de este catálogo.
In addition to the foregoing, this catalogue contains new data
that may prove of interest to all users:
Además de todo lo mencionado hasta ahora, este catálogo incorpora nuevos datos que pueden resultar muy interesantes para
cualquier usuario:
~ Option to learn about the packaging of each catalogue item
(Page 278)
~ Opción para conocer el embalaje de cada artículo del catálogo
(Pág. 278)
~ Option to search for articles alphabetically (Page 293)
~ Opción para buscar artículos en el índice por orden alfabético
(Pág. 293)
In keeping with its product and service improvement policy,
~ Tables to find the most suitable electronic ballast for fluorescent
lamps (Page 124)
~ Tablas para encontrar el balasto electrónico más adecuado para
las lámparas fluorescentes (Pág. 124)
~ Tables to find the most suitable control gear for eLED LINE
range modules (Page 51)
~ Tablas para encontrar la fuente de alimentación más adecuada
para los módulos de la gama eLED LINE (Pág. 51)
Septiembre 2014
September 2014
www.elt.es
5
LED INDEX
ÍNDICE LED
Constant current control gears for LED modules up to
50W. Protection class II and independent use. Universal
voltage 110-277V. IP20
Equipos de alimentación de corriente constante para
módulos de LED hasta 50W. Clase II y uso independiente. Tensión universal 110-277V. IP20 ...................... 19
CONSTANT CURRENT CONTROL GEARS
EQUIPOS DE ALIMENTACION DE CORRIENTE
CONSTANTE
Constant current control gears for LED modules
up to 10 W. IP20
Equipos de alimentación de corriente constante
para módulos de LED hasta 10 W. IP20 ................... 10
Constant current control gears for LED modules
up to 90W. IP20
Equipos de alimentación de corriente constante para
módulos de LED hasta 90W. IP20 ........................... 20
Constant current control gears for LED modules up to
16 and 25 W. IP20
Equipos de alimentación de corriente constante para
módulos de LED hasta 16 y 25 W. IP20 ................... 11
Constant current control gears for LED modules up to
50W. Universal voltage 110-277V. IP20
Equipos de alimentación de corriente constante para
módulos de LED hasta 50W.
Tensión Universal 110-277V. IP20 ........................... 21
Constant current control gears for LED modules up to
25W. Universal voltaje 110-277V. IP20
Equipos de alimentación de corriente constante para
módulos de LED hasta 25W.
Tensión universal 110-277V. IP20 ........................... 12
DALI dimmable Constant current control gear for LED
modules up to 90W
Equipos DALI regulables de alimentación de corriente
constante para módulos de LED hasta 90W ........... 22
Dimmable constant current control gears for LED modules up to 16 and 25 W. IP20
Equipos regulables de alimentación de corriente constante para módulos de LED hasta 16 y 25 W.
IP20 .......................................................................... 13
Constant current control gears for LED modules IP67
up to 10 W
Equipos de alimentación de corriente constante
para módulos de LED IP67 hasta 10 W .................. 24
Constant current control gears for LED modules
up to 60 W. IP20
Equipos de alimentación de corriente constante
para módulos de LED hasta 60 W. IP20 .................. 14
Constant current control gears for LED modules IP67
up to 25W
Equipos de alimentación de corriente constante
para módulos de LED IP67 hasta 25W .................... 25
Constant current control gears for LED modules
up to 52W. Universal voltage 110-240V. IP20
Equipos de alimentación de corriente constante para
módulos de LED hasta 52W.
Tensión universal 110-240V. IP20 ........................... 15
Constant current control gears for LED modules IP67
2x25 W
Equipos de alimentación de corriente constante para
módulos de LED IP67 2x25 ...................................... 26
Constant current control gears for LED modules
up to 50W. IP20
Equipos de alimentación de corriente constante para
módulos de LED hasta 50W. IP20 .......................... 16
Constant current control gears for LED modules up to
50W. IP20 Street lighting applications
Equipos de alimentación de corriente constante para
módulos de LED hasta 50W. IP20 Aplicaciones de alumbrado público ............................................................ 27
Constant current control gears for LED modules up to
50W. Universal voltage 110-277V. IP20
Equipos de alimentación de corriente constante para
módulos de LED hasta 50W. Tensión Universal 110277V. IP20 ............................................................... 17
Constant current control gears for LED modules up to
150W. IP20 Street lighting applications
Equipos de alimentación de corriente constante para
módulos de LED hasta 150W. IP20. Aplicaciones de
alumbrado público .................................................... 28
Constant current control gears for LED modules
up to 50W. Protection class II and independent use. IP20
Equipos de alimentación de corriente constante para
módulos de LED hasta 50W. Clase II y uso
independiente. IP20 ................................................. 18
8
www.elt.es
LED MODULES
MODULOS LED
LED modules eLED LINE 1 800
Módulos LED eLED LINE 1 800 ................................ 29
LED modules eLED LINE 1 1100
Módulos LED eLED LINE 1 1100 .............................. 32
LED modules eLED LINE 2 1350
Módulos LED eLED LINE 2 1350 .............................. 35
LED modules eLED LINE 2 2100
Módulos LED eLED LINE 2 2100 ............................. 38
LED modules accessories
Accesorios para módulos LED ................................ 41
LED modules eLED OCTO 1 1850
Módulos LED eLED OCTO 1 1850 ........................... 42
LED modules eLED OCTO 1 2250
Módulos LED eLED OCTO 1 2250 ........................... 45
LED modules eLED SQUARE 2 1700
Módulos LED eLED SQUARE 2 1700 ..................... 48
Combinations between -LC drivers and eLED LINE
modules
Combinaciones de fuentes de alimentación -LC
con módulos eLED LINE .......................................... 51
ELECTRONIC TRANSFORMERS FOR 12VAC LED
LAMPS
TRANSFORMADORES ELECTRÓNICOS PARA LÁMPARAS LED DE 12VAC ............................................ 61
CONSTANT VOLTAGE CONTROL GEARS
EQUIPOS DE ALIMENTACION DE TENSION
CONSTANTE
IP20 Constant voltage control gear for LED modules
Equipos de alimentación IP20 de tensión constante para
módulos LED ............................................................ 62
IP67 Constant voltage control gear for 100 or 200W LED
modules
Equipos de alimentación IP67 de tensión constante para
módulos LED de 100 o 200W ................................... 63
LED TECHNICAL INFORMATION
INFORMACIÓN TÉCNICA SOBRE LED .................. 65
www.elt.es
9
21
37
80
66
14
STANDARD CONTROL GEARS / EQUIPOS ESTANDAR
Model
Modelo
Ref.
No.
Output power
range
Output
current
Output voltage
range
Power
factor
System
GHſEKGPE[
Max.temp.
CVVERQKPV
1RGTCVKPI
temp.
Rango de potencia
en módulo
Corriente
de salida
Rango de tensión
de salida
Factor de
potencia
Rendimiento
del sistema
Temp.máx.
envolvente
Temp.
funcionamiento
Homologaciones
DC/AC 50-60Hz
Constant current control gears for LED modules up to 10 W. IP20
Equipos de alimentación de corriente constante para módulos de LED
hasta 10 W. IP20
Approvals
LC-B DLC-B
220-240V
W
mA
Vdc
NJ
dž
tc (°C)
ta (°C)
LC 102/350-B
9918026
1... 2
350
3... 7
0,73
75
75
-25… +55
01
LC 103/500-B
9918027
1... 3
500
3... 7
0,83
75
75
-25… +55
01
LC 104/700-B
9918028
1... 4
700
3... 7
0,90
75
80
-25… +55
01
LC 110/350-B
9918021
3... 10
350
9... 31
0,97
80
75
-25... +50
01
LC 110/500-B
9918022
4... 10,5
500
9... 21
0,97
80
80
-25... +50
01
LC 110/700-B
9918023
4... 10
700
6... 16
0,98
80
75
-25... +50
01
LC 109/1050-B
9918024
3... 9
1050
3... 9
0,96
80
75
-25... +50
01
DIMMABLE CONTROL GEARS / EQUIPOS REGULABLES
DLC 108/200-B
9918035
4... 8
200
20... 39
0,94
80
80
-25... +50
01
DLC 111/300-B
9918036
7... 11
300
25... 38
0,96
80
85
-25... +50
01
DLC 110/350-B
9918031
3... 10
350
9... 31
0,97
80
75
-25... +50
01
DLC 110/500-B
9918032
4... 10,5
500
9... 21
0,97
80
85
-25... +50
01
DLC 110/700-B
9918033
4... 10
700
6... 16
0,98
80
80
-25... +50
01
DLC 109/1050-B
9918034
3... 9
1050
3... 9
0,96
80
80
-25... +50
01
~ IP20 equipment.
~ Class II electrical protection.
~ Indoor use.
~ Equipped with terminal cover and cable clamps system.
~ Maximum length of secondary wire: 5 m.
~ Suitable for installation on wooden surfaces.
~ High power factor.
~ Overload protection.
~ Short circuit protection.
~ Protection against no load operation.
~ Withstands 2 hours at 350V (AC).
~ Permitted input voltage AC/DC: 198-264V.
~ Allowed dimmers for DLC models:
Trailing-edge and leading-edge dimming.
Dimming 5% - 100%.
~ Nominal lifetime at max. ta allowed: 50.000h (with a failure rate
max.0,2% per 1000h).
~ Equipos IP20.
~ Protección eléctrica Clase II.
~ Uso interior.
~ Equipados con cubre-clemas y sistema de prensa-cables.
~ Longitud máxima de los cables del secundario: 5 m.
~ Aptos para montaje sobre madera.
~ Alto factor de potencia.
~ Protección contra sobrecarga.
~ Protección contra cortocircuitos.
~ Protección en circuito abierto.
~ Soporta 2 horas a 350V (AC).
~ Tensión permitida AC/DC: 198-264V.
~ Tipo de regulador que admite los modelos DLC:
%QTVGCNſPCNFGNCHCUG[EQTVGCNRTKPEKRKQFGNCHCUG
Regulación 5% - 100%.
~ Vida útil a máxima ta permitida: 50.000h (tasa de fallo max. 0,2%
por 1000h).
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
2TQFWEVUGNGEVKQPRCICPFYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
Instructions manual on www.elt.es/productos/inst_manual.html
Recommended dimmers list on:
http://www.elt.es/productos/combinaciones/com_dimmers_DLC_B.pdf
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
Selección de producto pág. 51 y www.elt.es/productos/buscador_producto.html
Manual de instrucciones en www.elt.es/productos/manual_instrucciones.html
Lista de reguladores recomendados en:
http://www.elt.es/productos/combinaciones/com_dimmers_DLC_B.pdf
SELV
LC-B
EN-61347-2-13 Safety / Seguridad
EN-62384 Perfomance / Funcionamiento
EN-61000-3-2 Harmonics / Armónicos
EN-61000-3-3 EMC Emission / CEM
EN-55015 Interferences / Interferencias
EN-61547 EMC Immunity / Inmunidad CEM
DLC-B
Dimmer
10
www.elt.es
Constant current control gears for LED modules up to 16 and 25W.
IP20
Equipos de alimentación de corriente constante para módulos de LED
hasta 16 y 25 W. IP20
29
38
3,6
122
Modelo
Ref.
No.
Output
current
Rango de Corriente
potencia de salida
en módulo
Output
Output
voltage
voltage
range at 240V range at 110V
Rango de
tensión de
salida a 240V
Rango de
tensión de
salida a 110V
Vdc
Power
factor
System
GHſEKGPE[
Max.temp.
CVVERQKPV
1RGTCVKPI
temp.
Factor
Rendimiento Temp.máx.
Temp.
de
del sistema envolvente funcionamiento
potencia
Approvals
Model
Output
power
range
Homologaciones
131
W
mA
Vdc
NJ
dž
tc (°C)
ta (°C)
LC 116/350-A
9918010
4,2... 16
350
12...46
0,85
>85
85
-25...+55
01
LC 116/500-A
9918011
5... 16
500
10...32
0,85
>85
85
-25...+55
01
LC 116/700-A
9918012
4,2... 16
700
6...23
0,84
>85
75
-25...+50
LC 125/300-A
9918009
4,2... 25
300
14… 84
0,90
>85
85
-25... +55
(2)
LC 125/350-A
9918015
3,5... 25
350
10...72
15... 61
0,90
>85
85
-25...+55
(2)
LC 125/500-A
9918016
5... 25
500
10...50
12... 37
0,89
>85
85
-25...+65
LC 125/600-A
9918014
11,4... 25
600
19...42
0,90
>85
75
-25...+50
LC 125/700-A
9918019
14,8... 25
700
21...36
0,90
>85
75
-25...+50
01
01
01
01
~ IP20 equipment.
~ Class II electrical protection.
~ Indoor use.
~ Equipped with terminal cover and cable clamps.
~ Clamping screws on primary and secondary circuits for cables with
diameter: 3 mm to 8 mm.
~ Max. terminal section area 2,5 mm². (secondary circuit).
~ Maximum length of secondary cables: 5 m.
~ Suitable for installation on wooden surfaces.
~ Standby ecological mode: <0,4 W.
~ High power factor.
~ Thermal protection.
~ Overload protection.
~ Short circuit protection
~ Protection against no load operation.
~ LED module dynamic protection.
~ Permitted input voltage AC/DC: 198-264V.
~ Nominal lifetime at max. ta allowed: 50.000h (with a failure rate
max.0,2% per 1000h).
~ Output ripple current < 5%.
~ Equipos IP20.
~ Protección eléctrica Clase II.
~ Uso interiores.
~ Equipados con cubre-clemas y prensa-cables.
~ Cierra cables primario y secundario para conductores entre 3 y
8 mm. de diámetro.
~ Sección máxima en clemas del secundario: 2,5 mm².
~ Longitud máxima de los cables del secundario: 5 m.
~ Aptos para montaje sobre madera.
~ Modo ecológico de standby: consumo <0,4 W.
~ Alto factor de potencia.
~ Protección térmica.
~ Protección contra sobrecarga.
~ Protección contra cortocircuitos.
~ Protección en circuito abierto.
~ Protección dinámica del módulo de LED.
~ Tensión permitida AC/DC: 198-264V.
~ Vida útil a máxima ta permitida: 50.000h (tasa de fallo max. 0,2%
por 1000h).
~ Rizado de corriente de salida < 5%.
(1) Except LC 125/350-A and LC 125/500-A.
(2) 110-240V - Permitted input voltage AC/DC: 99-264V.
(1) Excepto LC 125/350-A y LC 125/500-A.
(2) 110-240V - Tensión permitida AC/DC: 99-264V.
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
2TQFWEVUGNGEVKQPRCICPFYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
Instructions manual on www.elt.es/productos/inst_manual.html
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
Selección de producto pág. 51 y www.elt.es/productos/buscador_producto.html
Manual de instrucciones en www.elt.es/productos/manual_instrucciones.html
1
SELV
110
OR < 5%
ORC
EN-61347-2-13 Safety / Seguridad
EN-62384 Perfomance / Funcionamiento
EN-61000-3-2 Harmonics / Armónicos
EN-61000-3-3 EMC Emission / CEM
EN-55015 Interferences / Interferencias
EN-61547 EMC Immunity / Inmunidad CEM
www.elt.es
LED
MODULES
11
LC-A
220-240V
DC/AC 50-60Hz
LC-A-UN
110-277V
DC/AC 50-60Hz
Constant current control gears for LED modules up to 25W.
Universal voltaje 110-277V. IP20
Equipos de alimentación de corriente constante para módulos de LED
hasta 25W. Tensión universal 110-277V. IP20
Available soon / Próximamente
29
38
3,6
122
131
Output
power
range
Model
Ref.
No.
Modelo
Output
current
Rango de Corriente
potencia en de salida
módulo
Output
voltage
range
Rango de
tensión de
salida
W
mA
Vdc
Power factor
Factor de
potencia
NJ
110V
230V
System
GHſEKGPE[
Max.temp.
at tc point
Operating
temp.
Approvals
Rendimiento Temp.máx.
Temp.
del sistema envolvente funcionamiento Homologaciones
dž
tc (°C)
ta (°C)
LC 125/350-A-UN
9918261
8... 25
350
23... 72
0,99
0,94
>85
80
-20...+50
*
01
LC 125/500-A-UN
9918262
8... 25
500
16... 50
0,99
0,94
>85
75
-20...+50
*
01
LC 125/700-A-UN
9918263
8,5… 25
700
12... 36
0,99
0,94
>85
80
-20...+50
*
01
~ IP20 equipment.
~ Class II electrical protection.
~ Indoor use.
~ Equipped with terminal cover and cable clamps.
~ Clamping screws on primary and secondary circuits for cables with
diameter: 3 mm to 8 mm.
~ Max. terminal section area 2,5 mm². (secondary circuit).
~ Maximum length of secondary cables: 5 m.
~ Suitable for installation on wooden surfaces.
~ High power factor.
~ Thermal protection.
~ Overload protection.
~ Short circuit protection
~ Protection against no load operation.
~ Permitted input voltage AC/DC: 99-305V.
~ Nominal lifetime at max. ta allowed: 50.000h (with a failure rate
max.0,2% per 1000h).
*In process
~ Equipos IP20.
~ Protección eléctrica Clase II.
~ Uso interiores.
~ Equipados con cubre-clemas y prensa-cables.
~ Cierra cables primario y secundario para conductores entre 3 y
8 mm. de diámetro.
~ Sección máxima en clemas del secundario: 2,5 mm².
~ Longitud máxima de los cables del secundario: 5 m.
~ Aptos para montaje sobre madera.
~ Alto factor de potencia.
~ Protección térmica.
~ Protección contra sobrecarga.
~ Protección contra cortocircuitos.
~ Protección en circuito abierto.
~ Tensión permitida AC/DC: 99-305V.
~ Vida útil a máxima ta permitida: 50.000h (tasa de fallo max. 0,2%
por 1000h).
*En proceso
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
2TQFWEVUGNGEVKQPRCICPFYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
Instructions manual on www.elt.es/productos/inst_manual.html
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
Selección de producto pág. 51 y www.elt.es/productos/buscador_producto.html
Manual de instrucciones en www.elt.es/productos/manual_instrucciones.html
SELV
EN-61347-2-13 Safety / Seguridad
EN-62384 Perfomance / Funcionamiento
EN-61000-3-2 Harmonics / Armónicos
EN-61000-3-3 EMC Emission / CEM
EN-55015 Interferences / Interferencias
EN-61547 EMC Immunity / Inmunidad CEM
LED
MODULES
12
www.elt.es
Dimmable constant current control gears for LED modules up to 16
and 25 W. IP20
Equipos regulables de alimentación de corriente constante
para módulos de LED hasta 16 y 25 W. IP20
DLC-A
220-240V
50-60Hz
29
38
3,6
122
Modelo
Ref.
No.
Output
current
Output voltage
range
Power
factor
System
GHſEKGPE[
Rango de potencia
en módulo
Corriente
de salida
Rango de
tensión de salida
Factor de
potencia
Rendimiento
del sistema
Max.temp.
at tc point
Operating
temp.
Temp.máx.
Temp.
envolvente funcionamiento
Homologaciones
Model
Output power
range
Approvals
131
W
mA
Vdc
NJ
dž
tc (°C)
ta (°C)
DLC 116/350-A
9918232
10… 16
350
29… 46
0,85
85
75
-25… +50
*
01
DLC 116/500-A
9918233
10… 16
500
20... 32
0,85
85
85
-25… +50
*
01
DLC 116/700-A
9918236
10… 16
700
14... 23
0,85
85
75
-25… +50
*
01
DLC 120/1050-A
9918247
10… 20
1050
10... 19
0,92
85
80
-25… +50
*
01
DLC 125/350-A
9918252
16… 25
350
45… 72
0,93
85
75
-25… +50
*
01
DLC 125/500-A
9918253
16… 25
500
32… 50
0,96
85
85
-25… +50
*
01
DLC 125/700-A
9918256
16… 25
700
23... 37
0,94
85
80
-25… +50
*
01
~ IP20 equipment.
~ Class II electrical protection.
~ Indoor use.
~ Equipped with terminal cover and cable clamps.
~ Clamping screws on primary and secondary circuits for cables with
diameter: 3 mm to 8 mm.
~ Max. terminal section area 2,5 mm². (secondary circuit).
~ Maximum length of secondary cables: 5 m.
~ Suitable for installation on wooden surfaces.
~ High power factor.
~ Overload protection.
~ Short circuit protection
~ Protection against no load operation.
~ Permitted input voltage AC/DC: 198-264V.
~ Allowed dimmers for DLC models:
Trailing-edge and leading-edge dimming.
Dimming 5% - 100%.
~ Nominal lifetime at max. ta allowed: 50.000h (with a failure rate
max.0,2% per 1000h).
*In process
~ Equipos IP20.
~ Protección eléctrica Clase II.
~ Uso interiores.
~ Equipados con cubre-clemas y prensa-cables.
~ Cierra cables primario y secundario para conductores entre 3 y
8 mm. de diámetro.
~ Sección máxima en clemas del secundario: 2,5 mm².
~ Longitud máxima de los cables del secundario: 5 m.
~ Aptos para montaje sobre madera.
~ Alto factor de potencia.
~ Protección contra sobrecarga.
~ Protección contra cortocircuitos.
~ Protección en circuito abierto.
~ Tensión permitida AC/DC: 198-264V.
~ Tipo de regulador que admite los modelos DLC:
%QTVGCNſPCNFGNCHCUG[EQTVGCNRTKPEKRKQFGNCHCUG
Regulación 5% - 100%.
~ Vida útil a máxima ta permitida: 50.000h (tasa de fallo max. 0,2%
por 1000h).
*En proceso
Data into this datasheet are subject to change without prior notice for
the purpose of products improvement. We kindly request you to ask
VJGNCVGUVURGEKſECVKQPU
Los datos de esta hoja de catálogo están sujeto a cambios sin previo
aviso por cuestiones de mejora de producto. Les rogamos reclamen
la documentación más actualizada.
Packaging and weight on www.elt.es/productos/packaging_ELT.pdf
2TQFWEVUGNGEVKQPQPYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
Instructions manual on www.elt.es/productos/inst_manual.html
Embalaje y peso en www.elt.es/productos/embalaje_ELT.pdf
Selección de producto en www.elt.es/productos/buscador_producto.html
Manual de instrucciones en www.elt.es/productos/manual_instrucciones.html
M
M
DLC-A
L
EN-61347-2-13 Safety / Seguridad
EN-62384 Perfomance / Funcionamiento
EN-61000-3-2 Harmonics / Armónicos
EN-61000-3-3 EMC Emission / CEM
EN-55015 Interferences / Interferencias
EN-61547 EMC Immunity / Inmunidad CEM
www.elt.es
Dimmer
13
LC-C
220-240V
DC/AC 50-60Hz
Constant current control gears for LED modules up to 60W. IP20
Equipos de alimentación de corriente constante para módulos de LED
hasta 60W. IP20
40
28
4,25
5
5
220
230
Output power
range
Model
Output current
Output voltage
range
Power factor
Factor de
potencia
System
GHſEKGPE[
Max.temp. at
VERQKPV
1RGTCVKPI
temp.
Rendimiento
del sistema
Temp.máx.
envolvente
Temp.
funcionamiento
Ref.
No.
Rango de
potencia en
módulo
Corriente de
salida
W
mA
Vdc
NJ
dž
tc (°C)
ta (°C)
LC 142/600-C
9918042
21... 42
600
35... 70
0,99
87
75
-25... +50
LC 142/650-C
9918043
21... 42
650
32... 65
0,99
87
75
-25... +50
LC 142/700-C
9918044
24... 42
700
34... 60
0,99
87
75
-25... +50
LC 152/600-C
9918045
30... 52
600
50... 86
0,99
87
75
-25... +50
LC 156/650-C
9918046
32... 56
650
50... 86
0,99
87
75
-25... +50
LC 160/700-C
9918040
24... 60
700
34... 86
0,99
87
75
-25... +50
Modelo
Rango de
tensión de
salida
~ IP20 equipment.
~ Driver for built-in use. Class I.
~ Maximum length of secondary cables: 2 m.
~ High power factor.
~ Overload protection.
~ Protection against no load operation.
~ Withstands 2 hours at 350V (AC).
~ Permitted input voltage AC: 198-264V; DC:150-270V.
`4CRKFEQPPGEVQTYKVJſZKPIURTKPI
Conductor size 0,5 - 1,5 mm2.
~ Nominal lifetime at max. ta allowed: 50.000h (with a failure rate
max.0,2% per 1000h).
~ Equipos IP20.
~ Equipo a incorporar. Clase I
~ Longitud máxima de los cables del secundario: 2 m.
~ Alto factor de potencia.
~ Protección contra sobrecarga
~ Protección en circuito abierto.
~ Soporta 2 horas a 350V (AC).
~ Tensión permitida AC: 198-264V; DC: 150-270V.
`%QPGEVQTGUFGEQPGZKÎPT¶RKFCEQPOWGNNGFGſLCEKÎP
.
Sección conductor 0,5 - 1,5 mm2.
~ Vida útil a máxima ta permitida: 50.000h (tasa de fallo max. 0,2%
por 1000h).
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
2TQFWEVUGNGEVKQPRCICPFYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
Instructions manual on www.elt.es/productos/inst_manual.html
'ODCNCLG[RGUQR¶I[YYYGNVGURTQFWEVQUGODCNCLGA'.6RFH
5GNGEEKÎPFGRTQFWEVQR¶I[YYYGNVGURTQFWEVQUDWUECFQTARTQFWEVQJVON
/CPWCNFGKPUVTWEEKQPGUGPYYYGNVGURTQFWEVQUOCPWCNAKPUVTWEEKQPGUJVON
EN-61347-2-13 Safety / Seguridad
EN-61000-3-2 Harmonics / Armónicos
EN-61000-3-3 EMC Emission / CEM
EN-55015 Interferences / Interferencias
EN-61547 EMC Immunity / Inmunidad CEM
-
LED
MODULES
+
L
N
14
www.elt.es
Constant current control gears for LED modules up to 52W.
7PKXGTUCNXQNVCIG8+2
Equipos de alimentación de corriente constante para módulos de LED
hasta 52W. Tensión universal 110-240V. IP20
40
28
4,25
5
5
220
230
Output power
range
Output
current
Output voltage
range
Ref. No.
Rango de potencia
en módulo
Corriente
de salida
Rango de tensión
de salida
W
mA
Vdc
LC 152/600-C-UN
9918080
21... 52
600
35... 86
LC 152/650-C-UN
9918081
23... 52
650
35... 80
LC 152/700-C-UN
9918082
25... 52
700
35... 75
Model
Modelo
System
GHſEKGPE[
Max.temp. at
VERQKPV
1RGTCVKPI
temp.
Rendimiento
del sistema
Temp.máx.
envolvente
Temp.
funcionamiento
NJ
dž
tc (°C)
ta (°C)
0,93
87
75
-25... +45
0,93
87
75
-25... +45
0,93
87
75
-25... +45
Power factor
Factor de
potencia
~ IP20 equipment.
~ Driver for built-in use. Class I.
~ Maximum length of secondary cables: 2 m.
~ High power factor.
~ Overload protection.
~ Protection against no load operation.
~ Withstands 2 hours at 350V (AC).
~ Permitted input voltage AC: 99-264V; DC: 99-270V.
`4CRKFEQPPGEVQTYKVJſZKPIURTKPI
Conductor size 0,5 - 1,5 mm2.
~ Nominal lifetime at max. ta allowed: 50.000h (with a failure rate
max.0,2% per 1000h).
~ Equipos IP20.
~ Equipo a incorporar. Clase I
~ Longitud máxima de los cables del secundario: 2 m.
~ Alto factor de potencia.
~ Protección contra sobrecarga
~ Protección en circuito abierto.
~ Soporta 2 horas a 350V (AC).
~ Tensión permitida AC: 99-264V; DC: 99-270V.
`%QPGEVQTGUFGEQPGZKÎPT¶RKFCEQPOWGNNGFGſLCEKÎP
.
Sección conductor 0,5 - 1,5 mm2.
~ Vida útil a máxima ta permitido: 50.000h (tasa de fallo max. 0,2%
por 1000h).
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
2TQFWEVUGNGEVKQPRCICPFYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
Instructions manual on www.elt.es/productos/inst_manual.html
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
Selección de producto pág. 51 y www.elt.es/productos/buscador_producto.html
Manual de instrucciones en www.elt.es/productos/manual_instrucciones.html
EN-61347-2-13 Safety / Seguridad
EN-61000-3-2 Harmonics / Armónicos
EN-61000-3-3 EMC Emission / CEM
EN-55015 Interferences / Interferencias
EN-61547 EMC Immunity / Inmunidad CEM
www.elt.es
+
L
N
15
LED
MODULES
LC-C-UN
110-240V
DC/AC 50-60Hz
29,5
Ø 4,2
69 63
92,5
108
STANDARD CONTROL GEARS / EQUIPOS ESTANDAR
Output
power range
Model
Output
current
Output voltage
range
Power
factor
System
GHſEKGPE[
Max.temp.
CVVERQKPV
1RGTCVKPI
temp.
Homologaciones
DC/AC 50-60Hz
Constant current control gears for LED modules up to 50W. IP20
Equipos de alimentación de corriente constante para módulos de LED
hasta 50W. IP20
Approvals
LC-E
220-240V
Ref.
No.
Rango de
potencia en
módulo
Corriente
de salida
W
mA
Vdc
NJ
dž
tc (°C)
ta (°C)
LC 150/350-E
9918171
23… 50
350
66… 143
0,98
90
75
-20… +50
01
LC 150/500-E
9918172
23… 50
500
46… 100
0,98
90
75
-20… +50
01
LC 150/700-E
9918173
24… 50
700
34… 72
0,98
89
75
-20… +50
01
LC 148/1050-E
9918174
23... 48
1050
22… 46
0,98
87
75
-20… +50
01
LC 142/1400-E
9918175
18… 42
1400
13… 30
0,98
86
75
-20… +50
01
Modelo
Factor de Rendimiento
Rango de
tensión de salida potencia del sistema
Temp.máx.
Temp.
envolvente funcionamiento
CONTROL GEARS WITH FAN OUTPUT / EQUIPOS CON SALIDA PARA VENTILADOR
LC 150/350-E-FAN
9918211
23… 50
350
66… 143
0,98
90
75
-20… +50
01
LC 150/500-E-FAN
9918212
23… 50
500
46… 100
0,98
90
75
-20… +50
01
LC 150/700-E-FAN
9918213
24… 50
700
34… 72
0,98
89
75
-20… +50
01
LC 148/1050-E-FAN
9918214
23… 48
1050
22… 46
0,98
87
75
-20… +50
01
LC 142/1400-E-FAN
9918215
18... 42
1400
13… 30
0,98
86
75
-20… +50
01
~ IP20 equipment.
~ Driver for built-in use. Class I.
~ Maximum length of secondary cables: 2 m.
~ High power factor.
~ Thermal protection.
~ Overload protection.
~ Short circuit protection.
~ Protection against no load operation.
~ Withstands 2 hours at 350V (AC).
~ Permitted input voltage AC/DC 198-264V.
`4CRKFEQPPGEVQTYKVJſZKPIURTKPI
Conductor size 0,5-1,5 mm2.
~ Drivers connection in series.
~ Nominal lifetime at max. ta allowed: 50.000h ( with a failure rate
max. 0,2% per 1000h).
~ (2) Output ripple current <2%.
~ THD <10%.
~ For further currents consult our commercial department.
~ Equipos IP20.
~ Equipo a incorporar. Clase I
~ Longitud máxima de los cables del secundario: 2 m.
~ Alto factor de potencia.
~ Protección térmica.
~ Protección contra sobrecarga
~ Protección contra cortocircuitos.
~ Protección en circuito abierto.
~ Soporta 2 horas a 350V (AC).
~ Tensión permitida AC/DC: 198-264V.
`%QPGEVQTGUFGEQPGZKÎPT¶RKFCEQPOWGNNGFGſLCEKÎP
.
Sección conductor 0,5-1,5 mm2.
~ Conexión de equipos en serie.
~ Vida útil a máxima ta permitida: 50.000h (tasa de fallo max. 0,2%
por 1000h).
~ (2) Rizado de corriente de salida <2%.
~ THD <10%.
~ Para otras corrientes consultar con el departamento comercial.
(1) Except LC 150/350-E and LC 148/1050-E.
LC 150/350-E-FAN and LC 148/1050-E-FAN.
(2) Except LC 148/1050-E and LC 148/1050-E-FAN. ORC<4%.
(1) Excepto LC 150/350-E y LC 148/1050-E.
LC 150/350-E-FAN y LC 148/1050-E-FAN.
(2) Excepto LC 1148/1050-E y LC 148/1050-E-FAN. ORC<4%.
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
2TQFWEVUGNGEVKQPRCICPFYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
Instructions manual on www.elt.es/productos/inst_manual.html
'ODCNCLG[RGUQR¶I[YYYGNVGURTQFWEVQUGODCNCLGA'.6RFH
5GNGEEKÎPFGRTQFWEVQR¶I[YYYGNVGURTQFWEVQUDWUECFQTARTQFWEVQJVON
/CPWCNFGKPUVTWEEKQPGUGPYYYGNVGURTQFWEVQUOCPWCNAKPUVTWEEKQPGUJVON
SELV
1
100
1
2
ORC < 2%
Standard control gear
Equipo estándar
With fan output
Con salida ventilador
EN-61347-2-13 Safety / Seguridad
EN-62384 Perfomance / Funcionamiento
EN-61000-3-2 Harmonics / Armónicos
EN-61000-3-3 EMC Emission / CEM
EN-55015 Interferences / Interferencias
EN-61547 EMC Immunity / Inmunidad CEM
12 Vdc
Imax150mA
N
L
N
L
OUTPUT
16
www.elt.es
Constant current control gears for LED modules up to 50W. Universal
voltage 110-277V. IP20
Equipos de alimentación de corriente constante para módulos de LED
hasta 50W. Tensión Universal 110-277V. IP20
29,5
Ø 4,2
69 63
92,5
108
Model
Modelo
Ref. No.
Output
current
Output Power
range
Output voltage
range
Power
factor
System
GHſEKGPE[
Max.temp.
at tc point
Operating
temp.
Corriente
de salida
Rango de potencia
en módulo
Rango de tensión
de salida
Factor de
potencia
Rendimiento
del sistema
Temp.máx.
envolvente
Temp.
funcionamiento
NJ
dž
tc (°C)
ta (°C)
W
mA
Vdc
110Vac
230Vac
110Vac
230Vac
LC 150/350-E-UN
9918271
350
23 ... 42
23 ... 50
66... 120
66... 143
0,98
91
75
-20...+50
LC 150/500-E-UN
9918272
500
23 ... 42
23 ... 50
46… 84
46... 100
0,98
91
75
-20...+50
LC 150/700-E-UN
9918273
700
24 ... 42
24 ... 50
34… 60
34... 72
0,98
89
75
-20...+50
LC 148/1050-E-UN
9918274
1050
23 ... 42
23 ... 48
22... 40
22... 46
0,98
89
75
-20...+50
LC 142/1400-E-UN
9918275
1400
18 ... 42
18 ... 42
13... 30
13... 30
0,98
85
75
-20...+50
~ IP20 equipment.
~ Driver for built-in use. Class I.
~ Maximum length of secondary cables: 2 m.
~ High power factor.
~ Thermal protection.
~ Overload protection.
~ Short circuit protection.
~ Protection against no load operation.
~ Withstands 2 hours at 350V (AC).
~ Permitted input voltage AC/DC 99-305V.
`4CRKFEQPPGEVQTYKVJſZKPIURTKPI
Conductor size 0,5-1,5 mm2.
~ Drivers connection in series.
~ Nominal lifetime at max. ta allowed: 50.000h ( with a failure rate
max. 0,2% per 1000h).
~ (2) Output ripple current <2%.
~ THD <10%.
~ For further currents consult our commercial department.
~ Equipos IP20.
~ Equipo a incorporar. Clase I
~ Longitud máxima de los cables del secundario: 2 m.
~ Alto factor de potencia.
~ Protección térmica.
~ Protección contra sobrecarga
~ Protección contra cortocircuitos.
~ Protección en circuito abierto.
~ Soporta 2 horas a 350V (AC).
~ Tensión permitida AC/DC: 99-305V.
`%QPGEVQTGUFGEQPGZKÎPT¶RKFCEQPOWGNNGFGſLCEKÎP
.
Sección conductor 0,5-1,5 mm2.
~ Conexión de equipos en serie.
~ Vida útil a máxima ta permitida: 50.000h (tasa de fallo max. 0,2%
por 1000h).
~ (2) Rizado de corriente de salida <2%.
~ THD <10%.
~ Para otras corrientes consultar con el departamento comercial.
(1) Except LC 150/350-E-UN and LC 148/1050-E-UN.
(2) Except LC 148/1050-E-UN and LC 142/1400-E-UN. ORC<3%.
(1) Excepto LC 150/350-E-UN y LC 148/1050-E-UN.
(2) Excepto LC 148/1050-E-UN y LC 142/1400-E-UN. ORC<3%.
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
2TQFWEVUGNGEVKQPRCICPFYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
Instructions manual on www.elt.es/productos/inst_manual.html
'ODCNCLG[RGUQR¶I[YYYGNVGURTQFWEVQUGODCNCLGA'.6RFH
5GNGEEKÎPFGRTQFWEVQR¶I[YYYGNVGURTQFWEVQUDWUECFQTARTQFWEVQJVON
/CPWCNFGKPUVTWEEKQPGUGPYYYGNVGURTQFWEVQUOCPWCNAKPUVTWEEKQPGUJVON
1
100
M
M
1
2
ORC < 2%
Standard control gear
Equipo estándar
EN-61347-2-13 Safety / Seguridad
EN-62384 Perfomance / Funcionamiento
EN-61000-3-2 Harmonics / Armónicos
EN-61000-3-3 EMC Emission / CEM
EN-55015 Interferences / Interferencias
EN-61547 EMC Immunity / Inmunidad CEM
www.elt.es
N
17
L
LC-E-UN
110-277V
DC/AC 50-60Hz
153,5
32
Ø4
70,2
4,5
2
160,5
170,5
STANDARD CONTROL GEARS / EQUIPOS ESTANDAR
Output
power range
Model
Output
voltage range
Output
current
Power
factor
System
GHſEKGPE[
Max.temp.
at tc point
Operating
temp.
Homologaciones
DC/AC 50-60Hz
Constant current control gears for LED modules up to 50W.
Protection class II and independent use. IP20
Equipos de alimentación de corriente constante para módulos de LED
hasta 50W. Clase II y uso independiente. IP20
Approvals
LC-E-C2
220-240V
Ref.
No.
Rango de
potencia en
módulo
Corriente
de salida
W
mA
Vdc
NJ
dž
tc (°C)
ta (°C)
LC 150/350-E-C2
9918181
23… 50
350
66… 143
0,98
90
75
-20… +50
01
LC 150/500-E-C2
9918182
23… 50
500
46… 100
0,98
90
75
-20… +50
01
LC 150/700-E-C2
9918183
24… 50
700
34… 72
0,98
89
75
-20… +50
01
LC 150/900-E-C2
9918187
23… 50
900
25… 55
0,98
88
75
-20… +50
01
LC 148/1050-E-C2
9918184
23... 48
1050
22… 46
0,98
87
75
-20… +50
01
LC 142/1400-E-C2
9918185
18… 42
1400
13… 30
0,98
86
75
-20… +50
01
Modelo
Rango de
tensión de
salida
Factor de Rendimiento
potencia del sistema
Temp.máx.
Temp.
envolvente funcionamiento
CONTROL GEARS WITH FAN OUTPUT / EQUIPOS CON SALIDA PARA VENTILADOR
LC 150/350-E-C2-FAN
9918221
23… 50
350
66… 143
0,98
90
75
-20… +50
01
LC 150/500-E-C2-FAN
9918222
23… 50
500
46… 100
0,98
90
75
-20… +50
01
LC 150/700-E-C2-FAN
9918223
24… 50
700
34… 72
0,98
89
75
-20… +50
01
LC 148/1050-E-C2-FAN
9918224
23… 48
1050
22… 46
0,98
87
75
-20… +50
01
LC 142/1400-E-C2-FAN
9918225
18... 42
1400
13… 30
0,98
86
75
-20… +50
01
~ IP20 equipment for independent use. Class II control gear
~ Maximum length of secondary cables: 5 m.
~ High power factor.
~ Thermal protection.
~ Overload protection.
~ Short circuit protection.
~ Protection against no load operation.
~ Withstands 2 hours at 350V (AC).
~ Permitted input voltage AC/DC: 198-264V.
`4CRKFEQPPGEVQTYKVJſZKPIURTKPI
Conductor size 0,5-1,5 mm2.
~ Drivers connection in series.
~ Nominal lifetime at max. ta allowed: 50.000h ( with a failure rate
max. 0,2% per 1000h).
~ (2) Output ripple current <2%.
~ THD <10%.
~ For further currents consult our commercial department.
~ Equipos para uso independiente IP20. Equipos Clase II
~ Longitud máxima de los cables del secundario: 5 m.
~ Alto factor de potencia.
~ Protección térmica.
~ Protección contra sobrecarga.
~ Protección contra cortocircuitos.
~ Protección en circuito abierto.
~ Soporta 2 horas a 350V (AC).
~ Tensión permitida AC/DC: 198-264V.
`%QPGEVQTGUFGEQPGZKÎPT¶RKFCEQPOWGNNGFGſLCEKÎP
.
Sección conductor 0,5-1,5 mm2.
~ Conexión de equipos en serie.
~ Vida útil a máxima ta permitida: 50.000h (tasa de fallo max. 0,2%
por 1000h).
~ (2) Rizado de corriente de salida <2%.
~ THD <10%.
~ Para otras corrientes consultar con el departamento comercial.
(1) Except LC 150/350-E-C2 and LC 148/1050-E-C2.
LC 150/350-E-C2-FAN and LC 148/1050-E-C2-FAN.
(2) Except LC 148/1050-E-C2 and LC 148/1050-E-C2-FAN.
ORC<4%.
(1) Excepto LC 150/350-E-C2 y LC 148/1050-E-C2.
LC 150/350-E-C2-FAN y LC 148/1050-E-C2-FAN.
(2) Excepto LC 1148/1050-E-C2 y LC 148/1050-E-C2-FAN.
ORC<4%.
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
2TQFWEVUGNGEVKQPRCICPFYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
Instructions manual on www.elt.es/productos/inst_manual.html
'ODCNCLG[RGUQR¶I[YYYGNVGURTQFWEVQUGODCNCLGA'.6RFH
5GNGEEKÎPFGRTQFWEVQR¶I[YYYGNVGURTQFWEVQUDWUECFQTARTQFWEVQJVON
/CPWCNFGKPUVTWEEKQPGUGPYYYGNVGURTQFWEVQUOCPWCNAKPUVTWEEKQPGUJVON
1
SELV
100
1
2
With fan output
Con salida ventilador
ORC < 2%
EN-61347-2-13 Safety / Seguridad
EN-62384 Perfomance / Funcionamiento
EN-61000-3-2 Harmonics / Armónicos
EN-61000-3-3 EMC Emission / CEM
EN-55015 Interferences / Interferencias
EN-61547 EMC Immunity / Inmunidad CEM
Standard control gear
Equipo estándar
12 Vdc
Imax150mA
N
L
N
L
OUTPUT
18
www.elt.es
Constant current control gears for LED modules up to 50W.
Protection class II and independent use. Universal voltage 110-277V.
IP20
Equipos de alimentación de corriente constante para módulos de LED
hasta 50W. Clase II y uso independiente. Tensión universal 110-277V.
IP20
Available soon / Próximamente
153,5
32
Ø4
70,2
4,5
2
160,5
170,5
Model
Modelo
Ref. No.
Output
current
Output Power
range
Corriente
de salida
Rango de potencia
en módulo
mA
W
Output voltage
range
Power
factor
System
GHſEKGPE[
Max.temp. at
tc point
Operating
temp.
Rendimiento
del sistema
Temp.máx.
envolvente
Temp.
funcionamiento
NJ
dž
tc (°C)
ta (°C)
Rango de tensión Factor de
potencia
de salida
Vdc
110Vac
230Vac
110Vac
230Vac
LC 150/350-E-C2-UN
9918281
350
23 ... 42
23 ... 50
66... 120
66... 143
0,98
91%
75
-20...+50
LC 150/500-E-C2-UN
9918282
500
23 ... 42
23 ... 50
46… 84
46... 100
0,98
91%
75
-20...+50
LC 150/700-E-C2-UN
9918283
700
24 ... 42
24 ... 50
34… 60
34... 72
0,98
89%
75
-20...+50
LC 148/1050-E-C2-UN
9918284
1050
23 ... 42
23 ... 48
22... 40
22... 46
0,98
89%
75
-20...+50
LC 142/1400-E-C2-UN
9918285
1400
18 ... 42
18 ... 42
13... 30
13... 30
0,98
85%
75
-20...+50
~ IP20 equipment for independent use. Class II control gear.
~ Maximum length of secondary cables: 5 m.
~ High power factor.
~ Thermal protection.
~ Overload protection.
~ Short circuit protection.
~ Protection against no load operation.
~ Withstands 2 hours at 350V (AC).
~ Permitted input voltage AC/DC 99-305V.
`4CRKFEQPPGEVQTYKVJſZKPIURTKPI
Conductor size 0,5-1,5 mm2.
~ Drivers connection in series.
~ Nominal lifetime at max. ta allowed: 50.000h ( with a failure rate
max. 0,2% per 1000h).
~ (2) Output ripple current <2%.
~ THD <10%.
~ For further currents consult our commercial department.
~ Equipos para uso independiente IP20. Equipos Clase II.
~ Longitud máxima de los cables del secundario: 5 m.
~ Alto factor de potencia.
~ Protección térmica.
~ Protección contra sobrecarga
~ Protección contra cortocircuitos.
~ Protección en circuito abierto.
~ Soporta 2 horas a 350V (AC).
~ Tensión permitida AC/DC: 99-305V.
`%QPGEVQTGUFGEQPGZKÎPT¶RKFCEQPOWGNNGFGſLCEKÎP
.
Sección conductor 0,5-1,5 mm2.
~ Conexión de equipos en serie.
~ Vida útil a máxima ta permitida: 50.000h (tasa de fallo max. 0,2%
por 1000h).
~ (2) Rizado de corriente de salida <2%.
~ THD <10%.
~ Para otras corrientes consultar con el departamento comercial.
(1) Except LC 150/350-E-C2-UN and LC 148/1050-E-C2-UN.
(2) Except LC 148/1050-E-C2-UN and LC 142/1400-E-C2-UN.
ORC<3%
(1) Excepto LC 150/350-E-C2-UN y LC 148/1050-E-C2-UN.
(2) Excepto LC 148/1050-E-C2-UN y LC 142/1400-E-C2-UN.
ORC<3%.
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
2TQFWEVUGNGEVKQPRCICPFYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
Instructions manual on www.elt.es/productos/inst_manual.html
'ODCNCLG[RGUQR¶I[YYYGNVGURTQFWEVQUGODCNCLGA'.6RFH
5GNGEEKÎPFGRTQFWEVQR¶I[YYYGNVGURTQFWEVQUDWUECFQTARTQFWEVQJVON
/CPWCNFGKPUVTWEEKQPGUGPYYYGNVGURTQFWEVQUOCPWCNAKPUVTWEEKQPGUJVON
1
SELV
100
1
2
ORC < 2%
Standard control gear
Equipo estándar
EN-61347-2-13 Safety / Seguridad
EN-62384 Perfomance / Funcionamiento
EN-61000-3-2 Harmonics / Armónicos
EN-61000-3-3 EMC Emission / CEM
EN-55015 Interferences / Interferencias
EN-61547 EMC Immunity / Inmunidad CEM
www.elt.es
N
19
L
LC-E-C2-UN
110-277V
DC/AC 50-60Hz
LC-D
220-240V
DC/AC 50-60Hz
Constant current control gears for LED modules up to 90W. IP20
Equipos de alimentación de corriente constante para módulos de LED
hasta 90W. IP20
5
348
7
30
21
4,5
10
4,25
5
5
350
360
Output
power range
Model
Output
current
Output
voltage range
Power
factor
System
GHſEKGPE[
Max.temp.
CVVERQKPV
1RGTCVKPI
temp.
Approvals
Temp.máx.
Temp.
envolvente funcionamiento Homologaciones
Ref.
No.
Rango de
potencia en
módulo
Corriente
de salida
W
mA
Vdc
NJ
dž
tc (°C)
ta (°C)
LC 150/350-D
9918103
23… 50
350
66… 143
0,98
90
75
-20… +55
01
LC 150/500-D
9918105
23… 50
500
46… 100
0,98
90
75
-20… +55
01
LC 142/700-D
9918102
24... 42
700
34... 60
0,98
89
75
-20… +55
01
LC 150/700-D
9918107
24… 50
700
34… 72
0,98
89
75
-20… +55
01
LC 148/1050-D
9918109
23… 48
1050
22… 46
0,98
87
75
-20… +50
01
LC 190/700-D
9918117
40… 90
700
58… 129
0,98
91
75
-20… +50
01
Modelo
Rango de
tensión de
salida
Factor de Rendimiento
potencia del sistema
~ IP20 equipment.
~ Driver for built-in use. Class I.
~ Maximum length of secondary cables: 2 m.
~ High power factor.
~ Overload protection.
~ Short circuit protection.
~ Protection against no load operation.
~ Withstands 2 hours at 350V (AC).
~ Permitted input voltage AC/DC: 198-264V.
`4CRKFEQPPGEVQTYKVJſZKPIURTKPI
Conductor size 0,5-1,5 mm2.
~ Nominal lifetime at max. ta allowed: 50.000h ( with a failure rate
max. 0,2% per 1000h).
~ (2) Output ripple current <2%.
~ THD <10%.
~ For further currents consult our commercial department.
~ Equipos IP20.
~ Equipo a incorporar. Clase I
~ Longitud máxima de los cables del secundario: 2 m.
~ Alto factor de potencia.
~ Protección contra sobrecarga
~ Protección contra cortocircuitos.
~ Protección en circuito abierto.
~ Soporta 2 horas a 350V (AC).
~ Tensión permitida AC/DC: 198-264V.
`%QPGEVQTGUFGEQPGZKÎPT¶RKFCEQPOWGNNGFGſLCEKÎP
.
Sección conductor 0,5-1,5 mm2.
~ Vida útil a máxima ta permitida: 50.000h (tasa de fallo max. 0,2%
por 1000h).
~ (2) Rizado de corriente de salida <2%.
~ THD <10%.
~ Para otras corrientes consultar con el departamento comercial.
(1) Except: LC 148/1050-D, LC 150/350-D and LC 190/700-D.
(2) Except: LC 148/1050-D. ORC<4%.
(1) Excepto: LC 148/1050-D, LC 150/350-D y LC 190/700-D.
(2) Excepto: LC 148/1050-D. ORC<4%.
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
2TQFWEVUGNGEVKQPRCICPFYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
Instructions manual on www.elt.es/productos/inst_manual.html
'ODCNCLG[RGUQR¶I[YYYGNVGURTQFWEVQUGODCNCLGA'.6RFH
5GNGEEKÎPFGRTQFWEVQR¶I[YYYGNVGURTQFWEVQUDWUECFQTARTQFWEVQJVON
/CPWCNFGKPUVTWEEKQPGUGPYYYGNVGURTQFWEVQUOCPWCNAKPUVTWEEKQPGUJVON
1
SELV 1
2
ORC < 2%
EN-61347-2-13 Safety / Seguridad
EN-62384 Perfomance / Funcionamiento
EN-61000-3-2 Harmonics / Armónicos
EN-61000-3-3 EMC Emission / CEM
EN-55015 Interferences / Interferencias
EN-61547 EMC Immunity / Inmunidad CEM
20
www.elt.es
Constant current control gears for LED modules up to 50W. Universal
voltage 110-277V. IP20
Equipos de alimentación de corriente constante para módulos de LED
hasta 50W. Tensión Universal 110-277V. IP20
Available soon / Próximamente
5
348
7
30
21
4,5
10
4,25
5
5
350
360
Output
power range
Model
Output
current
Output
voltage range
Power factor
Factor de
potencia
System
GHſEKGPE[
Max.temp. at
tc point
Operating
temp.
Rendimiento
del sistema
Temp.máx.
envolvente
Temp.
funcionamiento
Ref. No.
Rango de
potencia en
módulo
Corriente de
salida
W
mA
Vdc
NJ
dž
tc (°C)
ta (°C)
LC 150/350-D-UN
9918123
23... 50
350
66... 143
0,98
90
75
-20… +55
LC 150/500-D-UN
9918125
23... 50
500
46... 100
0,98
90
75
-20… +55
LC 150/700-D-UN
9918127
24... 50
700
34... 72
0,98
89
75
-20… +55
LC 148/1050-D-UN
9918129
23... 48
1050
22... 46
0,98
87
75
-20… +50
Modelo
Rango de
tensión de
salida
~ IP20 equipment.
~ Driver for built-in use. Class I.
~ Maximum length of secondary cables: 2 m.
~ High power factor.
~ Overload protection.
~ Short circuit protection.
~ Protection against no load operation.
~ Withstands 2 hours at 350V (AC).
~ Permitted input voltage AC/DC: 99-305V.
`4CRKFEQPPGEVQTYKVJſZKPIURTKPI
Conductor size 0,5-1,5 mm2.
~ Nominal lifetime at max. ta allowed: 50.000h ( with a failure rate
max. 0,2% per 1000h).
~ (2) Output ripple current <3%.
~ THD <10%.
~ For further currents consult our commercial department.
~ Equipos IP20.
~ Equipo a incorporar. Clase I
~ Longitud máxima de los cables del secundario: 2 m.
~ Alto factor de potencia.
~ Protección contra sobrecarga
~ Protección contra cortocircuitos.
~ Protección en circuito abierto.
~ Soporta 2 horas a 350V (AC).
~ Tensión permitida AC/DC: 99-305V.
`%QPGEVQTGUFGEQPGZKÎPT¶RKFCEQPOWGNNGFGſLCEKÎP
.
Sección conductor 0,5-1,5 mm2.
~ Vida útil a máxima ta permitida: 50.000h (tasa de fallo max. 0,2%
por 1000h).
~ (2) Rizado de corriente de salida <3%.
~ THD <10%.
~ Para otras corrientes consultar con el departamento comercial.
(1) Except: LC 148/1050-D-UN and LC 150/350-D-UN.
(2) Except: LC 148/1050-D-UN. ORC<5%.
(1) Excepto: LC 148/1050-D-UN y LC 150/350-D-UN.
(2) Excepto: LC 148/1050-D-UN. ORC<5%.
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
2TQFWEVUGNGEVKQPRCICPFYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
Instructions manual on www.elt.es/productos/inst_manual.html
'ODCNCLG[RGUQR¶I[YYYGNVGURTQFWEVQUGODCNCLGA'.6RFH
5GNGEEKÎPFGRTQFWEVQR¶I[YYYGNVGURTQFWEVQUDWUECFQTARTQFWEVQJVON
/CPWCNFGKPUVTWEEKQPGUGPYYYGNVGURTQFWEVQUOCPWCNAKPUVTWEEKQPGUJVON
1
SELV 1
2
ORC < 2%
EN-61347-2-13 Safety / Seguridad
EN-62384 Perfomance / Funcionamiento
EN-61000-3-2 Harmonics / Armónicos
EN-61000-3-3 EMC Emission / CEM
EN-55015 Interferences / Interferencias
EN-61547 EMC Immunity / Inmunidad CEM
www.elt.es
21
LC-D-UN
110-277V
DC/AC 50-60Hz
DALI dimmable Constant current control gear for LED modules
up to 90W
Equipos DALI regulables de alimentación de corriente
constante para módulos de LED hasta 90W
5
348
7
30
21
4,5
10
4,25
5
5
350
Output
power range
Model
Output
current
Output
voltage range
Power
factor
System
GHſEKGPE[
Max.temp.
at tc point
Operating
temp.
Homologaciones
360
Approvals
DLC-D
DALI
220-240V
50-60Hz
Ref. No.
Rango de
potencia en
módulo
Corriente
de salida
W
mA
Vdc
NJ
dž
tc (°C)
ta (°C)
DLC 150/700-D-DALI
9918137
27… 50
700
39… 72
0,98
89
75
-20… +55
01
DLC 190/700-D-DALI
9918147
45… 90
700
64…129
0,98
91
75
-20… +50
01
Modelo
Rango de
tensión de
salida
Factor de Rendimiento
potencia del sistema
Temp.máx.
Temp.
envolvente funcionamiento
~ IP20 equipment.
~ Dimming control by DALI inerface.
~ Regulation range 3...100%.
~ PWM output dimming.
~ Regulation by Touch Dim.
~ Corridor function.
~ Driver for built-in use. Class I.
~ Maximum length of secondary cables: 2 m.
~ Standby ecological mode: consumption <0,4W
~ Low Total Harmonic Distortions (THD) at maximum power <8%.
~ High power factor.
~ Dynamic thermal protection.
~ Overload protection.
~ Short circuit protection.
~ Protection against no load operation.
~ Withstands 2 hours at 350V (AC).
~ Permitted input voltage AC/DC: 198-264V.
`4CRKFEQPPGEVQTYKVJſZKPIURTKPI
Conductor size 0,5 - 1,5 mm2.
~ Nominal lifetime at max. ta allowed: 50.000h ( with a failure rate
max. 0,2% per 1000h).
~ Output ripple current <2%.
~ Equipos IP20.
~ Control de regulación mediante interfaz DALI.
~ Rango de regulación de 3… 100%.
~ Regulación a la salida por PWM.
~ Control de regulación mediante Touch Dim.
~ Función corridor.
~ Equipo a incorporar. Clase I
~ Longitud máxima de los cables del secundario: 2 m.
~ Modo ecológico de standby: consumo <0,4W.
~ Bajo factor de distorsión armónica (THD) a máxima carga <8%.
~ Alto factor de potencia.
~ Protección térmica dinámica.
~ Protección contra sobrecarga.
~ Protección contra cortocircuitos.
~ Protección en circuito abierto.
~ Soporta 2 horas a 350V (AC).
~ Tensión permitida AC/DC: 198-264V.
`%QPGEVQTGUFGEQPGZKÎPT¶RKFCEQPOWGNNGFGſLCEKÎP
Sección conductor 0,5 - 1,5 mm2.
~ Vida útil a máxima ta permitida: 50.000h (tasa de fallo max. 0,2%
por 1000h).
~ Rizado de corriente de salida <3%.
~ For further currents consult our commercial department.
~ Para otras corrientes consultar con el departamento comercial.
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
2TQFWEVUGNGEVKQPRCICPFYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
Instructions manual on www.elt.es/productos/inst_manual.html
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
Selección de producto pág. 51 y www.elt.es/productos/buscador_producto.html
Manual de instrucciones en www.elt.es/productos/manual_instrucciones.html
DALI
DA
DA
DALI
DA / LS
DA / N
L
N
DAL I
90
PWM Output Dimming
ORC < 2%
EN-61347-2-13 Safety / Seguridad
EN-62384 Perfomance / Funcionamiento
EN-61000-3-2 Harmonics / Armónicos
EN-61000-3-3 EMC Emission / CEM
EN-55015 Interferences / Interferencias
EN-61547 EMC Immunity / Inmunidad CEM
EN 62386-101 DALI General requirements system
EN 62386-102 DALI General requirements control gear
EN 62386-207 DALI Particular requirements for control gear. LED modules
22
CORRIDOR
TOUCH
SENSOR
L N
CORRIDOR
DA / LS
DA / N
L
N
TOUCH
TOUCH
DA / LS
DA / N
L
N
www.elt.es
DALI control gear: characteristics and technical information
Equipo DALI: Características e información técnica
Ŗ&KOOCDNGD[&#.+QT6QWEJ&+/HTQOVQQHVJG
TCVGFNWOKPQWUƀWZ
Ŗ4GIWNCDNGRQT&#.+Q617%*&+/EQPTCPIQFGTGIWNCEKÎP
FGNCNFGNƀWLQNWOKPQUQ
TOUCH
DALI
%
Luminous
Flux
100
90
80
70
60
50
40
30
20
10
0
%
Luminous
Flux
0,0
0,5
1,0
1,5
2,5
2,0
3,0
3,5
100
90
80
70
60
50
40
30
20
10
0
4,0
0
50
Time (sec)
100
150
200
250
Digital Light Value
~ DALI interface: protected DALI control input against
overvoltage. Polarity free.
~ Interfaz DALI: Los terminales del control DALI están
protegidos frente a sobretensiones. Sin polaridad.
~ Touch DIM: by using standard commercial normally
open switches.
~ TOUCH DIM: Regulación manual con pulsador estándar
(NA: Normalmente abierto).
TOUCH
DALI
L3
L2
L1
N
L1
N
DA / LS
DA / N
Push
button
L
N
LED
MODULES
DLC ...-DALI
DA / LS
DA / N
L N PE DA DA
DALI
controller
DA / LS
DA / N
L
N
L
N
LED
MODULES
DLC ...-DALI
DA / LS
DA / N
L
N
DA / LS
DA / N
L
N
LS
LED
MODULES
DLC ...-DALI
DA / LS
DA / N
L
N
N L1
DA DA
~ Corridor function: Dimming system that controls light
level when a presence is detected by a conventional
mains on/off sensor connected in DALI input. When the
sensor detects a presence, light level increases up to
100%, otherwise the control gear keeps on providing
10% light level.
DLC ...-DALI
LED
MODULES
DLC ...-DALI
LED
MODULES
DLC ...-DALI
LED
MODULES
N L1 L2 L3
~ Función corridor: sistema para controlar el nivel de luz
con un sensor de movimiento convencional conectado
en los bornes DALI. Cuando el sensor detecta presencia, el nivel de luz aumenta al 100%, en caso contrario,
el equipo mantiene un 10% de nivel de luz.
Ŗ2TQVGEVKQPU
Effective thermal management protection reducing lumiPQWUƀWZYJGPFGVGEVGZEGUUKXGKPVGTPCNVGORGTCVWTG
Ŗ2
TQVGEEKQPGU
Protección térmica inteligente de forma que el equipo
TGFWEGGNƀWLQNWOKPQUQCNFGVGEVCTWPGZEGUQFGVGORGTCtura interna.
~ Si la temperatura en Tc sobrepasa 80°C, se reduce la
potencia un 25%.
~ Si la temperatura en Tc baja a 70°C una vez la potencia
se ha reducido en un 25%, el equipo vuelve a funcionamiento normal.
~ Si la temperatura en Tc aumenta hasta 85°C una vez se
ha reducido la potencia un 25%, el equipo pasa a modo
stand-by.
~ Cuando el equipo está en stand-by y la temperatura en
Tc baja a 70°C, el equipo reenciende en funcionamiento
normal.
~ If Tc temperature exceeds 80º C, power is reduced by
25%.
~ If temperature decreases to Tc 70° C once power has
been reduced by 25%, gear returns to normal operation.
~ If Tc temperature increases to 85° C once power has been
reduced by 25%, gear switches to standby mode.
~ When gear is on standby and Tc temperature decreases
to 70° C, gear reboots in normal operation mode.
n
Encendido
Funcionamiento normal
NO
100%
Tc >80°C?
YES/SI
Light level
25% power re
n
Reducción de un 25% de la potencia
Tc >85°C?
Nivel de flujo
luminoso
YES/SI
Stand-by (OFF)
10%
NO
NO
Tc <70°C?
YES/SI
www.elt.es
NO
Tc <70°C?
OFF
YES/SI
23
60 seg.
32 seg.
LC-IP67
220-240V
DC/AC 50-60Hz
Constant current control gears for LED modules IP67 up to 10 W
Equipos de alimentación de corriente constante para módulos de LED
IP67 hasta 10 W
34
67
200
40,5
STANDARD CONTROL GEARS / EQUIPOS ESTANDAR
Output power
range
Model
Output
current
Output
voltage range
Power factor
Factor de
potencia
System
GHſEKGPE[
Max.temp. at
VERQKPV
1RGTCVKPI
temp.
Rendimiento
del sistema
Temp.máx.
envolvente
Temp.
funcionamiento
Ref. No.
Rango de
potencia en
módulo
Corriente de
salida
W
mA
Vdc
NJ
dž
tc (°C)
ta (°C)
LC 110/350-EN
9916021
3…10
350
9...31
0,97
80
75
-25 .. +50
LC 110/500-EN
9916022
4…10
500
9...21
0,97
80
80
-25 .. +50
LC 110/700-EN
9916023
4…10
700
6...16
0,98
80
75
-25 .. +50
LC 109/1050-EN
9916024
3…9
1050
3...9
0,98
80
75
-25 .. +50
Modelo
Rango de
tensión de
salida
DIMMABLE CONTROL GEARS / REGULABLES
DLC 110/350-EN
9916081
3…10
350
9...31
0,97
80
75
-25 .. +50
DLC 110/500-EN
9916082
4…10
500
9...21
0,97
80
85
-25 .. +50
DLC 110/700-EN
9916083
4…10
700
6...16
0,98
80
80
-25 .. +50
DLC 109/1050-EN
9916084
3…9
1050
3...9
0,98
80
80
-25 .. +50
~ Class II electrical protection.
~ Maximum length of secondary wire: 5 m.
~ High power factor.
~ Overload protection.
~ Short circuit protection.
~ Protection against no load operation.
~ Withstands 2 hours at 350V (AC).
~ Permitted input voltage AC/DC: 198-264V.
~ Allowed dimmers for DLC models:
Trailing-edge and leading-edge dimming.
Dimming 5% - 100%.
~ IP67 equipment.
~ Nominal lifetime at max. ta allowed: 50.000h (with a failure rate
max.0,2% per 1000h).
~ Input transient, surge and strike protection device ITP is suitable for
this driver pag. 90 and www.elt.es\productos\pdf\701000000.pdf.
~ ENEC driver inside.
~ Protección eléctrica Clase II.
~ Longitud máxima de los cables del secundario: 5 m.
~ Alto factor de potencia.
~ Protección contra sobrecarga.
~ Protección contra cortocircuitos.
~ Protección en circuito abierto.
~ Soporta 2 horas a 350V (AC).
~ Tensión permitida AC/DC: 198-264V.
~ Tipo de regulador que admite los modelos DLC:
%QTVGCNſPCNFGNCHCUG[EQTVGCNRTKPEKRKQFGNCHCUG
Regulación 5% - 100%.
~ Equipos IP67.
~ Vida útil a máxima ta permitida: 50.000h (tasa de fallo max. 0,2%
por 1000h).
`'SWKRQEQORCVKDNGEQPGNUKUVGOCFGRTQVGEEKÎPEQPVTCTC[QUG
KORWNUQUGPNCGPVTCFC+62R¶I[
www.elt.es\productos pdf\701000000.pdf.
~ Incorpora driver ENEC.
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
2TQFWEVUGNGEVKQPRCICPFYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
Instructions manual on www.elt.es/productos/inst_manual.html
'ODCNCLG[RGUQR¶I[YYYGNVGURTQFWEVQUGODCNCLGA'.6RFH
5GNGEEKÎPFGRTQFWEVQR¶I[YYYGNVGURTQFWEVQUDWUECFQTARTQFWEVQJVON
/CPWCNFGKPUVTWEEKQPGUGPYYYGNVGURTQFWEVQUOCPWCNAKPUVTWEEKQPGUJVON
LC 1...-EN
DLC 1...-EN
SELV
L
Rojo / Red
N
Negro / Black
Rojo / Red
24
Negro / Black
EN-61347-2-13 Safety / Seguridad
EN-62384 Perfomance / Funcionamiento
EN-61000-3-2 Harmonics / Armónicos
EN-61000-3-3 EMC Emission / CEM
EN-55015 Interferences / Interferencias
EN-61547 EMC Immunity / Inmunidad CEM
N
L
Dimmer
www.elt.es
Constant current control gears for LED modules IP67 up to 25W
Equipos de alimentación de corriente constante para módulos de LED
IP67 hasta 25W
D
C
B
W
mA
Factor
Rendimiento
Rango de
de
tensión de potencia del sistema
salida a
110V
Vdc
Vdc
NJ
dž
tc (°C)
ta (°C)
A
mm
B
mm
Dimensiones
Rango de
tensión de
salida a 240V
System
GHſEKGPE[
&KOGPUKQPU
Modelo
Rango de Corriente
potencia de salida
en módulo
Power
factor
Temp. funcionamiento
Ref.
No.
Output
voltage
range at
110V
1RGTCVKPIVGOR
Model
Output
current
Output
voltage
range at 240V
/CZVGORCVVERQKPV
Output
power
range
Temp.máx. envolvente
A
C
D
mm mm
LC 116/350-EN-2
9916000
16
350
12...46
0,85
>85
70
-25... +55
209
184,5
49
33
LC 116/500-EN-2
9916001
16
500
10...32
0,85
>85
70
-25... +55
209
184,5
49
33
LC 116/700-EN-2
9916002
16
700
6...23
0,84
>85
70
-25... +55
209
184,5
49
33
(2)
LC 125/350-EN-2
9916010
25
350
10...72
15... 61
0,90
>85
70
-25... +55
209
184,5
49
33
(2)
LC 125/500-EN-2
9916011
25
500
10...50
12... 37
0,89
>85
70
-25... +55
209
184,5
49
33
9916012
25
700
21...36
0,90
>85
70
-25... +55
209
184,5
49
33
LC 125/700-EN-2
~ Class II electrical protection.
~ IP67 equipment.
~ Connection with double insulated cables, hose type.
~ Available with 1.000V double insulate cables 0,75mm2.
~ Maximum length of secondary cables: 5 m.
~ Standby ecological mode: <0,4 W.
~ High power factor.
~ Thermal protection.
~ Overload protection.
~ Short circuit protection.
~ Protection against no load operation.
~ LED module dynamic protection.
~ Permitted input voltage AC/DC: 198-264V.
~ ENEC driver inside.
~ Nominal lifetime at max. ta allowed: 50.000h (with a failure rate
max.0,2% per 1000h).
~ Input transient, surge and strike protection device ITP is suitable for
this driver pag. 90 and www.elt.es\productos\pdf\701000000.pdf.
(1) Except LC 125/350-EN-2 and LC 125/500-EN-2.
(2) 110-240V - Permitted input voltage AC/DC: 99-264V.
~ Protección eléctrica Clase II.
~ Equipos IP67.
~ Con conexiones por cables de doble aislamiento, tipo manguera.
~ Disponibles con cables manguera de 1.000V, 0,75mm2.
~ Longitud máxima de los cables del secundario: 5 m.
~ Modo ecológico de standby: consumo <0,4 W.
~ Alto factor de potencia.
~ Protección térmica.
~ Protección contra sobrecarga.
~ Protección contra cortocircuitos.
~ Protección en circuito abierto.
~ Protección dinámica del módulo de LED.
~ Tensión permitida AC/DC: 198-264V.
~ Incorpora driver ENEC.
~ Vida útil a máxima ta permitida: 50.000h (tasa de fallo max. 0,2%
por 1000h).
~ Equipo compatible con el sistema de protección contra rayos e
impulsos en la entrada ITP pág. 90 y
www.elt.es\productos\pdf\701000000.pdf.
(1) Excepto LC 125/350-EN-2 y LC 125/500-EN-2.
(2) 110-240V - Tensión permitida AC/DC: 99-264V.
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
2TQFWEVUGNGEVKQPRCICPFYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
Instructions manual on www.elt.es/productos/inst_manual.html
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
Selección de producto pág. 51 y www.elt.es/productos/buscador_producto.html
Manual de instrucciones en www.elt.es/productos/manual_instrucciones.html
tc
1
SELV
110
EN-61347-2-13 Safety / Seguridad
EN-62384 Perfomance / Funcionamiento
EN-61000-3-2 Harmonics / Armónicos
EN-61000-3-3 EMC Emission / CEM
EN-55015 Interferences / Interferencias
EN-61547 EMC Immunity / Inmunidad CEM
+
_
www.elt.es
25
Black
Brown
Blue
Blue
L
N
LC-EN-2
IP67
220-240V
DC/AC 50-60Hz
D
C
Format 1
Formato 1
B
Format 2
Formato 2
A
Output
power
range
Model
Ref.
No.
Modelo
Output
current
Rango de Corriente
potencia de salida
en módulo
W
mA
Output
voltage
range
Rango
de
tensión
de
salida
Vdc
Power
factor
System
GHſEKGPE[
Max.temp.
CVVERQKPV
1RGTCVKPI
temp.
&KOGPUKQPU
Format
Factor
Rendimiento Temp.máx.
Temp.
de
del sistema envolvente funcionamiento Formato
potencia
NJ
dž
tc (°C)
Dimensiones
A
B
C
D
mm mm mm mm
ta (°C)
LC 225/350-EN
9926010
2x25
350
9... 72
0,90
85
70
-25... +55
1
198
180
89
34
LC 225/500-EN
9926020
2x25
500
12... 55
0,89
85
70
-25... +55
1
198
180
89
34
LC 225/700-EN
9926030
2x25
700
3... 37
0,92
85
70
-25... +55
1
198
180
89
34
LC 225/350-EN-2
9926011
2x25
350
9... 72
0,90
85
70
-25... +55
2
340
325
49
33
LC 225/500-EN-2
9926021
2x25
500
12... 55
0,89
85
70
-25... +55
2
340
325
49
33
LC 225/700-EN-2
9926031
2x25
700
3... 37
0,92
85
75
-25... +50
2
340
325
49
33
~ Class II electrical protection.
~ IP67 equipment.
~ Connection with double insulated cables, hose type.
~ Available with 1.000V double insulate cables 0,75mm2.
~ Maximum length of secondary cables: 5 m.
~ Standby ecological mode: <0,4 W.
~ High power factor.
~ Thermal protection.
~ Overload protection.
~ Short circuit protection.
~ Protection against no load operation.
~ LED module dynamic protection.
~ Permitted input voltage AC/DC: 198-264V.
~ ENEC driver inside.
~ Nominal lifetime at max. ta allowed: 50.000h (with a failure rate
max.0,2% per 1000h).
~ Input transient, surge and strike protection device ITP is suitable for
this driver pag. 90 and www.elt.es\productos\pdf\701000000.pdf.
(1) Exclusively LC 225/700-EN and LC 225/700-EN-2
~ Protección eléctrica Clase II.
~ Equipos IP67.
~ Con conexiones por cables de doble aislamiento, tipo manguera.
~ Disponibles con cables manguera de 1.000V, 0,75mm2.
~ Longitud máxima de los cables del secundario: 5 m.
~ Modo ecológico de standby: consumo <0,4 W.
~ Alto factor de potencia.
~ Protección térmica.
~ Protección contra sobrecarga.
~ Protección contra cortocircuitos.
~ Protección en circuito abierto.
~ Protección dinámica del módulo de LED.
~ Tensión permitida AC/DC: 198-264V.
~ Incorpora driver ENEC.
~ Vida útil a máxima ta permitida: 50.000h (tasa de fallo max. 0,2%
por 1000h).
~ Equipo compatible con el sistema de protección contra rayos e
impulsos en la entrada ITP pág. 90 y
www.elt.es\productos\pdf\701000000.pdf).
(1) Exclusivamente LC 225/700-EN y LC 225/700-EN-2
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
2TQFWEVUGNGEVKQPRCICPFYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
Instructions manual on www.elt.es/productos/inst_manual.html
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
Selección de producto pág. 51 y www.elt.es/productos/buscador_producto.html
Manual de instrucciones en www.elt.es/productos/manual_instrucciones.html
UP
tc
1
SELV
25W max
DC/AC 50-60Hz
Constant current control gears for LED modules IP67 2x25 W
Equipos de alimentación de corriente constante para módulos de LED
IP67 2x25 W
110
EN-61347-2-13 Safety / Seguridad
EN-62384 Perfomance / Funcionamiento
EN-61000-3-2 Harmonics / Armónicos
EN-61000-3-3 EMC Emission / CEM
EN-55015 Interferences / Interferencias
EN-61547 EMC Immunity / Inmunidad CEM
25W max
LC-EN
IP67
220-240V
26
IP-67
Black
-
Black
+
Blue
-
Black
+
Brown
Blue
L
N
INPUT
Blue
VDC
OUTPUT
www.elt.es
Constant current control gears for LED modules up to 50W.
IP20 Street lighting applications
Equipos de alimentación de corriente constante para módulos de LED
hasta 50W. IP20 Aplicaciones de alumbrado público
29,5
Ø 4,2
69 63
92,5
108
Output
power range
Model
Output
current
Output voltage
range
Power
factor
System
GHſEKGPE[
Max.temp. at
tc point
Operating
temp.
Rango de
tensión de salida
Factor de
potencia
Rendimiento
del sistema
Temp.máx.
envolvente
Temp.
funcionamiento
Ref. No.
Rango de
potencia en
módulo
Corriente de
salida
W
mA
Vdc
NJ
dž
tc (°C)
ta (°C)
LC 150/350-E-VDR
9918291
23… 50
350
66… 143
0,98
90
75
-20… +50
LC 150/500-E-VDR
9918292
23… 50
500
46… 100
0,98
90
75
-20… +50
LC 150/700-E-VDR
9918293
24… 50
700
34… 72
0,98
89
75
-20… +50
LC 148/1050-E-VDR
9918294
23... 48
1050
22… 46
0,98
87
75
-20… +50
LC 142/1400-E-VDR
9918295
18… 42
1400
13… 30
0,98
86
75
-20… +50
Modelo
~ IP20 equipment.
~ Driver for built-in use. Class I.
~ Maximum length of secondary cables: 2 m.
~ High power factor.
~ Thermal protection.
~ Overload protection.
~ Short circuit protection.
~ Protection against no load operation.
~ Enhanced protection against surge pulses: 4Kv between phases.
~ Withstands 2 hours at 350V (AC).
~ Permitted input voltage AC/DC 198-264V.
`4CRKFEQPPGEVQTYKVJſZKPIURTKPI
Conductor size 0,5-1,5 mm2.
~ Drivers connection in series.
~ Nominal lifetime at max. ta allowed: 50.000h ( with a failure rate
max. 0,2% per 1000h).
~ (2) Output ripple current <2%.
~ THD <10%.
~ For further currents consult our commercial department.
~ Available with 12Vdc 150mA FAN output upon request
(LC-E-FAN-VDR).
~ Available in Class II version upon request (LC-E-C2-VDR)
~ Input transient, surge and strike protection device ITP is suitable for
this driver pag. 90 and www.elt.es\productos\pdf\701000000.pdf.
(1) Except LC 150/350-E-VDR and LC 148/1050-E-VDR.
(2) Except LC 148/1050-E-VDR. ORC<4%.
~ Equipos IP20.
~ Equipo a incorporar. Clase I
~ Longitud máxima de los cables del secundario: 2 m.
~ Alto factor de potencia.
~ Protección térmica.
~ Protección contra sobrecarga
~ Protección contra cortocircuitos.
~ Protección en circuito abierto.
~ Protección reforzada contra impulsos de sobretensión en red: 4Kv
entre fases.
~ Soporta 2 horas a 350V (AC).
~ Tensión permitida AC/DC: 198-264V.
`%QPGEVQTGUFGEQPGZKÎPT¶RKFCEQPOWGNNGFGſLCEKÎP
.
Sección conductor 0,5-1,5 mm2.
~ Conexión de equipos en serie.
~ Vida útil a máxima ta permitida: 50.000h (tasa de fallo max. 0,2%
por 1000h).
~ (2) Rizado de corriente de salida <2%.
~ THD <10%.
~ Para otras corrientes consultar con el departamento comercial.
`&KURQPKDNGDCLQFGOCPFCEQPUCNKFC8FEO#RCTCXGPVKNCFQT
(LC-E-FAN-VDR).
`&KURQPKDNGDCLQFGOCPFCEQPGPXQNXGPVG%NCUG++
.%'%8&4
~ Equipo compatible con el sistema de protección contra rayos e
impulsos en la entrada ITP pág. 90 y
www.elt.es\productos\pdf\701000000.pdf.
(1) Excepto LC 150/350-E-VDR y LC 148/1050-E-VDR.
(2) Excepto LC 148/1050-E-VDR. ORC<4%.
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
2TQFWEVUGNGEVKQPRCICPFYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
Instructions manual on www.elt.es/productos/inst_manual.html
'ODCNCLG[RGUQR¶I[YYYGNVGURTQFWEVQUGODCNCLGA'.6RFH
5GNGEEKÎPFGRTQFWEVQR¶I[YYYGNVGURTQFWEVQUDWUECFQTARTQFWEVQJVON
/CPWCNFGKPUVTWEEKQPGUGPYYYGNVGURTQFWEVQUOCPWCNAKPUVTWEEKQPGUJVON
SELV
1
100
1
EN-61347-2-13 Safety / Seguridad
EN-62384 Perfomance / Funcionamiento
EN-61000-3-2 Harmonics / Armónicos
EN-61000-3-3 EMC Emission / CEM
EN-55015 Interferences / Interferencias
EN-61547 EMC Immunity / Inmunidad CEM
www.elt.es
2
ORC < 2%
4
L-N
4
L-N
N
27
L
LC-E-VDR
220-240V
DC/AC 50-60Hz
LC-XT
220-240V
DC/AC 50-60Hz
Constant current control gears for LED modules up to 150W. IP20
Street lighting applications
Equipos de alimentación de corriente constante para módulos de LED
hasta 150W. IP20. Aplicaciones de alumbrado público
38,3
154,4
144,6
78,5 93,4
Model
Modelo
Output
power
range
Ref.
No.
Output
voltage
range
Output
current
Rango de
potencia en
módulo
Corriente
de salida
Rango de
tensión de
salida
Power
factor
System
GHſEKGPE[
Factor de Rendimiento
potencia del sistema
Max.temp.
at tc point
Operating
temp.
Approvals
Temp.máx.
Temp.
envolvente funcionamiento Homologaciones
W
mA
Vdc
NJ
dž
tc (°C)
ta (°C)
LC 190/350-XT
9916101
50… 90
350
142… 258
0,96
89
75
-40... +60
*
01
LC 190/500-XT
9916102
45… 90
500
90… 180
0,96
89
75
-40... +60
*
01
LC 190/700-XT
9916103
60… 90
700
85… 129
0,96
89
75
-40... +60
*
01
LC 190/1050-XT
9916104
50… 90
1050
48... 86
0,96
89
75
-40... +60
*
01
LC 1150/700-XT
9916113
98… 150
700
140… 215
0,98
91
75
-40… +55
*
01
LC 1150/1050-XT
9916114
95… 150
1050
90,5… 143
0,98
91
75
-40… +55
*
01
LC 1150/1200-XT
9916115
110... 150
1200
91,5... 125
0,98
91
75
-40... +55
*
01
LC 1150/1400-XT
9916116
125… 150
1400
89… 108
0,98
91
75
-40… +55
*
01
~ Built-in-use control gear, protection index IP20.
~ High power factor.
~ Overload protection.
~ Protection against no load operation.
~ Enhanced protection against surge pulses: 6Kv between phases.
`'HſEKGPVRTQVGEVKQPCICKPUV'5&KPVJG.'&OQFWNG
~ Withstands 2 hours at 350V (AC).
~ Permitted input voltage AC/DC: 198-264V.
~ Nominal lifetime at max. ta allowed: 50.000h ( with a failure rate
max. 0,2% per 1000h).
~ Output ripple current <4%.
~ THD <10%.
~ Electronic circuit fully protected against humidity.
~ For further currents, consult our commercial department.
~ Input transient, surge and strike protection device ITP is suitable for
this driver pag. 90 and www.elt.es\productos\pdf\701000000.pdf.
(1) Exclusively LC 190/1050-XT and LC 1150/1400-XT.
~ Equipos a incorporar, indice de proteccón IP20.
~ Alto factor de potencia.
~ Protección contra sobrecarga.
~ Protección en circuito abierto.
~ Protección reforzada contra impulsos de sobretensión en red: 6Kv
entre fases.
~ Protección contra estática en la salida.
~ Soporta 2 horas a 350V (AC).
~ Tensión permitida AC/DC: 198-264V.
~ Vida útil a máxima ta permitida: 50.000h (tasa de fallo max. 0,2%
por 1000h).
~ Rizado de corriente de salida <4%.
~ THD <10%.
~ Circuito electrónico protegido contra la humedad.
~ Para otras corrientes consultar con el departamento comercial.
~ Equipo compatible con el sistema de protección contra rayos
e impulsos en la entrada ITP pág. 90 y (www.elt.es\productos\
pdf\701000000.pdf).
*En proceso
(1) Exclusivamente LC 190/1050-XT y LC 1150/1400-XT.
Data into this datasheet are subject to change without prior notice for
the purpose of products improvement. We kindly request you to ask
VJGNCVGUVURGEKſECVKQPU
Los datos de esta hoja de catálogo están sujetos a cambios sin
previo aviso por cuestiones de mejora de producto. Les rogamos
reclamen la documentación más actualizada.
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
2TQFWEVUGNGEVKQPRCICPFYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
Instructions manual on www.elt.es/productos/inst_manual.html
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
Selección de producto pág. 51 y www.elt.es/productos/buscador_producto.html
Manual de instrucciones en www.elt.es/productos/manual_instrucciones.html
*In process
1
SELV
100
1
EN-61347-2-13 Safety / Seguridad
EN-62384 Perfomance / Funcionamiento
EN-61000-3-2 Harmonics / Armónicos
EN-61000-3-3 EMC Emission / CEM
EN-55015 Interferences / Interferencias
EN-61547 EMC Immunity / Inmunidad CEM
ORC < 4%
6
LED
MODULES
ODP
L-N
ODP
L
mains
N
28
www.elt.es
LED modules eLED LINE 1 800
Módulos LED eLED LINE 1 800
eLED LINE
280mm
800
R
6,1
1,6
2,8
Ø4
18,4
24
15
62,5
62,5
62,5
62,5
15
280
~ LED Module appropriate for operation in constant current.
`*KIJNWOKPQWUGHſEKGPE[
~ Low voltage of the module, allowing applications up to more than
4.000lm with a voltage under 50V.
~ Low heating of the module due to the independent operation of the
LED in low current.
~ Built-in luminaires.
Unidades por caja
7PKVURGTDQZ
Temp. Máx. En la unión
/CZ6GOR+PVJGLWPEVKQP
Temp. funcionamiento
Flujo luminoso
típico a temp.
amb. 25 °C
1RGTCVKPIVGOR
Rango de Temp.
tensión de color
típica
Temp. máx. en tc
Intensidad
máxima
6[RKECN
NWOKPQWUƀWZ
CVCODVGOR
25 °C
CRI
Potencia
típica en
módulo
Colour
temp.
/CZVGORCVVERQKPV
Ref.
No.
Modelo
6[RKECN
voltage
range
'ſEKGPEKCNWOKPQUCVÈRKEC
Model
/CZKOWO
current
6[RKECNNWOKPQWUGHſECE[
6[RKECN
RQYGTKP
module
~ Módulo de LED apropiado para funcionamiento en corriente
constante.
`#NVCGſEKGPEKCNWOÈPKEC
~ Baja tensión del módulo lo que permite aplicaciones de hasta más
de 4.000lm con una tensión inferior a 50V.
~ Bajo calentamiento del módulo debido al funcionamiento
independiente del LED a baja corriente.
~ Instalación en luminaria.
W
mA
V
*K
*lm
lm / W
tc (°C)
ta (°C)
eLED LINE 1 800 830
9950502
6,4
700
8,7... 9,6
3000
750
117
>80
75
-40… +55
Tj (°C)
110
120
eLED LINE 1 800 840
9950501
6,4
700
8,7... 9,6
4000
800
125
>80
75
-40… +55
110
120
eLED LINE 1 800 857
9950503
6,4
700
8,7... 9,6
5700
820
129
>80
75
-40… +55
110
120
.WOKPQWUƀWZVQNGTCPEGvCPFHQTEQNQWTVGORGTCVWTGvIWCTCPVGGKPICUVCPFCTFFGXKCVKQPQHvRGTOQFWNGG.'&
Tolerancia de Flujo Luminoso de ±7% y de Temperatura de Color ±7% asegurando una desviación típica de un ±3% por módulo eLED
~ Beam angle 120°.
~ Color tolerance: 3 MacAdam’s ellipses - 3SDCM.
~ Excellent thermal performance, not require further dissipation
~ Dimmable.
~ Indifferent installation position.
~ Anti-reverse polarity protection.
~ Designed upon ZHAGA requirements book 7 cat. LLE-L28W2.
~ Push wire connection.
~ The connector allows connection and disconnection.
~ Wire gauge: 0,2... 0,75 mm2.
~ Stripping length: 6...7 mm.
`.QPINKHGVKOGQHJQWTUCV6ENWOKPQWUƀWZQH CHVGT
this time period.
~ Angulo de visión 120°.
~ Tolerancia de color: 3 elipses de MacAdam - 3SDCM.
~ Bajo calentamiento del módulo, no requiere ningún tipo de
disipación extra.
~ Regulable.
~ Posición de la operación indiferente.
~ Protección contra inversión de polaridad.
~ Diseñado bajo requerimiento ZHAGA libro 7 cat. LLE-L28W2.
~ Conexión mediante conector rápido.
~ Conector que permite conexión y desconexión.
~ Sección conductor: 0,2... 0,75 mm2.
~ Longitud de pelado: 6... 7 mm.
`.CTICXKFCFGJQTCUC6EEQPƀWLQNWOKPQUQ FGURWÃU
de este periodo.
~ Made in 5RCKP.
~ 5 years warranty in combination with an appropriate ELT driver.
~ Fabricado en España.
~ Garantía de 5 años en combinación con driver ELT apropiado.
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
2TQFWEVUGNGEVKQPRCICPFYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
Selección de producto pág. 51 y www.elt.es/productos/buscador_producto.html
RoHS
EN 62031 Safety / Seguridad
EN 62471 Photo-biological / Fotobiológica
www.elt.es
29
R
LUMINOUS FLUX DATA
DATOS DEL FLUJO LUMINOSO
Lumenes (lm)
6[RKECNNWOKPQWUƀWZ
CVCODVGORu%
Current
Colour Temperature
Intensidad
Temperatura de Color
Flujo luminoso típico a
temp. amb. 25 °C
mA
*K
*lm
3000
750
4000
800
5700
820
3000
560
4000
600
5700
620
3000
420
4000
450
5700
460
900
800
700
700
500
350
600
3000K
Fila
4000K
Fila
5700K
Fila
500
400
300
200
300
350
400
Corriente (mA)
.WOKPQWUƀWZVQNGTCPEGvCPFHQTEQNQWTVGORGTCVWTGv
IWCTCPVGGKPICUVCPFCTFFGXKCVKQPQHvRGTOQFWNGG.'&
Tolerancia de Flujo Luminoso de ±7% y de Temperatura de Color ±7%
asegurando una desviación típica de un ±3% por módulo eLED
450
500
550
600
650
700
…….. 1050
LED BIN SELECTION
ELECCIÓN DEL BIN DEL LED
Each eLED LINE is made with approved LED and selected
previously during our logistic process, considering brightness, colour and voltage, obtaining guaranteed uniformity
and quality of the light.
$TKIJVPGUU%JQKEGQH.'&UYKVJJKIJGHſEKGPE[VQGPUWTG
NWOGPUYCVVURGEKſGF
8QNVCIG Tolerance in each LED of maximum 0,1V.
%QNQWT The possible variation of LED colour is imperceptible to the human eye, and as a result gives 3
MacAdam’s ellipses: 3SDCM.
Cada eLED LINE se fabrica con LED previamente acordado y seleccionado en nuestro proceso logístico, en cuanto a
Brillo, Color y Tensión, de esta forma la uniformidad y calidad de la luz está garantizada.
Brillo: 'NGEEKÎP FG NQU .'&U EQP CNVQ PKXGN FG GſEKGPEKC
RCTCICTCPVK\CTNQUNÕOGPGUYCVKQGURGEKſECFQU
Tensión: Tolerancia en cada LED máxima de 0,1V.
Color: La posible variación de color de los LED es imperceptible al ojo humano, dando como resultado 3 elipses de
MacAdam: 3SDCM.
LUMINOUS INTENSITY DISTRIBUTION
CURVES (Cd/Klm) @700mA
CURVAS DE DISTRIBUCIÓN DE
INTENSIDAD LUMÍNICA (Cd/Klm) @700mA
This luminous intensity distribution curve is the result of
the information obtained with an unique eLED LINE module
without any type of optics.
Esta curva de distribución de intensidad lumínica es el resultado de los datos obtenidos de un único modulo eLED
LINE sin ningún tipo de óptica.
30
www.elt.es
R
EXAMPLES OF COMBINATION
eLED LINE AND ELT DRIVER @700mA
R
~
~
EJEMPLOS DE COMBINACIONES
eLED LINE Y DRIVER ELT @700mA
PRI
1 x 1 eLED
+
SEC
R
R
DRIVER
{
1 x 2 eLED
+ SEC -
R
~ PRI ~
1
Driver LC 110/700-B
280 mm
800 Lm
9,2 Vout
6,4 W
R
R
R
DRIVER
R
1
2
{
Driver LC 116/700-A
2 x 280 = 560 mm
2 x 800 = 1.600 Lm
2 x 9,2 = 18,4 Vout
2 x 6,4 = 12,8 W
R
L
N
DRIVER
R
R
R
R
R
1
R
R
2
3
R
4
R
R
5
1 x 5 eLED
{
1
2
R
3
R
R
Driver LC 142/700-C
5 x 280 = 1.400 mm
5 x 800 = 4.000 Lm
5 x 9,2 = 46 Vout
5 x 6,4 = 32 W
4
R
R
R
R
DRIVER
R
R
R
R
5
6
1
2
R
L
N
R
4 x 280 = 1.120 mm
R
R
7
R
R
8
2 x 4 eLED
{
R
R
R
R
2 x 280 = 560 mm
4 x 2 eLED
3
R
4
R
R
R
{
Driver LC 160/700-C
8 x 800 = 6.400 Lm
8 x 9,2 = 73,6 Vout
8 x 6,4 = 51,2 W
R
DRIVER
R
R
R
5
R
R
7
R
L
N
6
R
R
8
2TQFWEVUGNGEVKQPRCICPFYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
Selección de producto pág. 51 y www.elt.es/productos/buscador_producto.html
#UUGODN[CPF5CHGV[+PHQTOCVKQP
Información de instalación y de seguridad
The eLED LINE must be applied to dry and clean surfaces
that are free from dust, oil, silicone or other soiling.
'NOÎFWNQFGDGUGTKPUVCNCFQGPUWRGTſEKGUUGECU[NKOpias, libres de polvo, aceite, silicona u otra suciedad.
eLED LINE products are sensitive to mechanical efforts,
avoid applying mechanical tensions, bending stresses, millings, pressure, or any other form of mechanical stress on
them.
Los productos eLED LINE son sensibles a esfuerzos mecánicos, evite aplicar tensiones mecánicas, esfuerzos de
ƀGZKÎPHTGUCFQURTGUKÎPQEWCNSWKGTQVTCHQTOCFGGUVTÃU
mecánico.
eLED LINE modules should be taken by the edges of the
printed circuit board, never by the top side where the LED
components are.
Tome los módulos eLED LINE por los bordes del circuito
impreso, nunca sobre la cara top donde se sitúan los componentes LED.
Handle eLED LINE products in protected zones against
static electricity. (ESD Electric Static Discharge).
Manipule los productos eLED LINE en zonas protegidas
contra la electricidad estática. (ESD Electric Static Discharge).
A gap between consecutive modules is recommended to
facilitate the thermal expansion.
Se recomienda dejar una separación entre módulos consecutivos para favorecer las dilataciones.
0,5 mm
www.elt.es
31
LED modules eLED LINE 1 1100
Módulos LED eLED LINE 1 1100
R
6,1
1,6
Ø4
4,4
31,2
40
30
30
110
110
280
~ LED Module appropriate for operation in constant current.
`*KIJNWOKPQWUGHſEKGPE[
~ Low voltage of the module, allowing applications up to more than
4.000lm with a voltage under 50V.
~ Low heating of the module due to the independent operation of the
LED in low current.
~ Built-in luminaires.
Unidades por caja
7PKVURGTDQZ
Temp. Máx. En la unión
Flujo luminoso
típico a temp.
amb. 25 °C
/CZ6GOR+PVJGLWPEVKQP
Temp.
de color
Temp. funcionamiento
Rango
de
tensión
típica
1RGTCVKPIVGOR
Intensidad
máxima
Temp. máx. en tc
Potencia
típica en
módulo
6[RKECN
NWOKPQWUƀWZ
CVCODVGOR
25 °C
/CZVGORCVVERQKPV
Ref.
No.
Colour
temp.
CRI
Modelo
6[RKECN
voltage
range
'ſEKGPEKCNWOKPQUCVÈRKEC
Model
6[RKECN
RQYGTKP /CZKOWO
module
current
~ Módulo de LED apropiado para funcionamiento en corriente
constante.
`#NVCGſEKGPEKCNWOÈPKEC
~ Baja tensión del módulo lo que permite aplicaciones de hasta más
de 4.000lm con una tensión inferior a 50V.
~ Bajo calentamiento del módulo debido al funcionamiento
independiente del LED a baja corriente.
~ Instalación en luminaria.
6[RKECNNWOKPQWUGHſECE[
eLED LINE
280x40mm
1100
W
mA
V
*K
*lm
lm / W
tc (°C)
ta (°C)
eLED LINE 1 1100 830
9950508
8,5
700
11,6... 12,8
3000
1000
117
>80
75
-40… +55
Tj (°C)
110
80
eLED LINE 1 1100 840
9950509
8,5
700
11,6... 12,8
4000
1070
125
>80
75
-40… +55
110
80
eLED LINE 1 1100 857
9950510
8,5
700
11,6... 12,8
5700
1100
129
>80
75
-40… +55
110
80
.WOKPQWUƀWZVQNGTCPEGvCPFHQTEQNQWTVGORGTCVWTGvIWCTCPVGGKPICUVCPFCTFFGXKCVKQPQHvRGTOQFWNGG.'&
Tolerancia de Flujo Luminoso de ±7% y de Temperatura de Color ±7% asegurando una desviación típica de un ±3% por módulo eLED
~ Beam angle 120°.
~ Color tolerance: 3 MacAdam’s ellipses - 3SDCM.
~ Excellent thermal performance, not require further dissipation
~ Dimmable.
~ Indifferent installation position.
~ Anti-reverse polarity protection.
~ Designed upon ZHAGA requirements book 7 cat. LLE-L28W4.
~ Push wire connection.
~ The connector allows connection and disconnection.
~ Wire gauge: 0,2... 0,75 mm2.
~ Stripping length: 6...7 mm.
`.QPINKHGVKOGQHJQWTUCV6ENWOKPQWUƀWZQH CHVGT
this time period.
~ Angulo de visión 120°.
~ Tolerancia de color: 3 elipses de MacAdam - 3SDCM.
~ Bajo calentamiento del módulo, no requiere ningún tipo de
disipación extra.
~ Regulable.
~ Posición de la operación indiferente.
~ Protección contra inversión de polaridad.
~ Diseñado bajo requerimiento ZHAGA libro 7 cat. LLE-L28W4.
~ Conexión mediante conector rápido.
~ Conector que permite conexión y desconexión.
~ Sección conductor: 0,2... 0,75 mm2.
~ Longitud de pelado: 6... 7 mm.
`.CTICXKFCFGJQTCUC6EEQPƀWLQNWOKPQUQ FGURWÃU
de este periodo.
~ Made in 5RCKP.
~ 5 years warranty in combination with an appropriate ELT driver.
~ Fabricado en España.
~ Garantía de 5 años en combinación con driver ELT apropiado.
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
2TQFWEVUGNGEVKQPRCICPFYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
Selección de producto pág. 51 y www.elt.es/productos/buscador_producto.html
EN 62031 Safety / Seguridad
EN 62471 Photo-biological / Fotobiológica
32
www.elt.es
R
LUMINOUS FLUX DATA
DATOS DEL FLUJO LUMINOSO
Lumenes (lm)
6[RKECNNWOKPQWUƀWZ
CVCODVGORu%
Current
Colour Temperature
Intensidad
Temperatura de Color
Flujo luminoso típico a
temp. amb. 25 °C
mA
*K
*lm
3000
1000
4000
1070
5700
1100
3000
750
4000
800
5700
820
3000
560
4000
600
5700
620
1200
1100
1000
900
700
500
350
800
3000K
Fila 3
Fila 4
4000K
Fila 5
5700K
700
600
500
400
300
200
300
350
400
Corriente (mA)
.WOKPQWUƀWZVQNGTCPEGvCPFHQTEQNQWTVGORGTCVWTGv
IWCTCPVGGKPICUVCPFCTFFGXKCVKQPQHvRGTOQFWNGG.'&
Tolerancia de Flujo Luminoso de ±7% y de Temperatura de Color ±7%
asegurando una desviación típica de un ±3% por módulo eLED
450
500
550
600
650
700
…….. 1050
LED BIN SELECTION
ELECCIÓN DEL BIN DEL LED
Each eLED LINE is made with approved LED and selected
previously during our logistic process, considering brightness, colour and voltage, obtaining guaranteed uniformity
and quality of the light.
$TKIJVPGUU%JQKEGQH.'&UYKVJJKIJGHſEKGPE[VQGPUWTG
NWOGPUYCVVURGEKſGF
8QNVCIG Tolerance in each LED of maximum 0,1V.
%QNQWT The possible variation of LED colour is imperceptible to the human eye, and as a result gives 3
MacAdam’s ellipses: 3SDCM.
Cada eLED LINE se fabrica con LED previamente acordado y seleccionado en nuestro proceso logístico, en cuanto a
Brillo, Color y Tensión, de esta forma la uniformidad y calidad de la luz está garantizada.
Brillo: 'NGEEKÎP FG NQU .'&U EQP PKXGN CNVQ FG GſEKGPEKC
RCTCICTCPVK\CTNQUNÕOGPGUYCVKQGURGEKſECFQU
Tensión: Tolerancia en cada LED máxima de 0,1V.
Color: La posible variación de color de los LED es imperceptible al ojo humano, dando como resultado 3 elipses de
MacAdam: 3SDCM.
LUMINOUS INTENSITY DISTRIBUTION
CURVES (Cd/Klm) @700mA
CURVAS DE DISTRIBUCIÓN DE
INTENSIDAD LUMÍNICA (Cd/Klm) @700mA
This luminous intensity distribution curve is the result of
the information obtained with an unique eLED LINE module
without any type of optics.
Esta curva de distribución de intensidad lumínica es el resultado de los datos obtenidos de un único modulo eLED
LINE sin ningún tipo de óptica.
www.elt.es
33
R
EXAMPLES OF COMBINATION
eLED LINE AND ELT DRIVER @700mA
R
~
~
EJEMPLOS DE COMBINACIONES
eLED LINE Y DRIVER ELT @700mA
PRI
1 x 1 eLED
+
SEC
DRIVER
R
R
R
~ PRI ~
{
1 x 2 eLED
+ SEC -
Made in Spain (EU)
1
Driver LC 110/700-B
280 mm
1.070 Lm
12,2 Vout
8,5 W
DRIVER
R
R
R
R
1
2
{
Driver LC 125/700-A
2 x 280 = 560 mm
2 x 1.070 = 2.140 Lm
2 x 12,2 = 24,4 Vout
2 x 8,5 = 17 W
R
L
N
DRIVER
R
R
R
R
R
1
R
R
3
2
R
R
R
5
4
{
1 x 5 eLED
R
R
R
DRIVER
R
R
L
N
R
R
R
R
4 x 280 = 1.120 mm
R
4
3
R
2
R
1
R
R
5
6
1
2
R
R
Driver LC 160/700-C
5 x 280 = 1.400 mm
5 x 1.070 = 5.350 Lm
5 x 12,2 = 61 Vout
5 x 8,5 = 42,5 W
R
8
7
2 x 4 eLED
R
R
{
R
R
2 x 280 = 560 mm
4 x 2 eLED
4
3
{
Driver LC 190/700-D
8 x 1.070 = 8.560 Lm
8 x 12,2 = 97,6 Vout
8 x 8,5 = 68 W
R
R
R
R
R
DRIVER
L
N
R
R
R
6
5
R
R
R
7
R
R
8
2TQFWEVUGNGEVKQPRCICPFYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
Selección de producto pág. 51 y www.elt.es/productos/buscador_producto.html
Assembly and Safety Information
Información de instalación y de seguridad
6JGG.'&.+0'OWUVDGCRRNKGFVQFT[CPFENGCPUWTHCEGU
VJCVCTGHTGGHTQOFWUVQKNUKNKEQPGQTQVJGTUQKNKPI
'NOÎFWNQFGDGUGTKPUVCNCFQGPUWRGTſEKGUUGECU[NKOpias, libres de polvo, aceite, silicona u otra suciedad.
G.'& .+0' RTQFWEVU CTG UGPUKVKXG VQ OGEJCPKECN GHHQTVU
CXQKFCRRN[KPIOGEJCPKECNVGPUKQPUDGPFKPIUVTGUUGUOKNNKPIU RTGUUWTG QT CP[ QVJGT HQTO QH OGEJCPKECN UVTGUU QP
VJGO
Los productos eLED LINE son sensibles a esfuerzos mecánicos, evite aplicar tensiones mecánicas, esfuerzos de
ƀGZKÎPHTGUCFQURTGUKÎPQEWCNSWKGTQVTCHQTOCFGGUVTÃU
mecánico.
G.'&.+0'OQFWNGUUJQWNFDGVCMGPD[VJGGFIGUQHVJG
RTKPVGF EKTEWKV DQCTF PGXGT D[ VJG VQR UKFG YJGTG VJG .'&
EQORQPGPVUCTG
Tome los módulos eLED LINE por los bordes del circuito
impreso, nunca sobre la cara top donde se sitúan los componentes LED.
*CPFNG G.'& .+0' RTQFWEVU KP RTQVGEVGF \QPGU CICKPUV
UVCVKEGNGEVTKEKV[
'5&'NGEVTKE5VCVKE&KUEJCTIG
Manipule los productos eLED LINE en zonas protegidas
contra la electricidad estática. (ESD Electric Static Discharge).
#ICRDGVYGGPEQPUGEWVKXGOQFWNGUKUTGEQOOGPFGFVQ
HCEKNKVCVGVJGVJGTOCNGZRCPUKQP
Se recomienda dejar una separación entre módulos consecutivos para favorecer las dilataciones.
0,5 mm
34
www.elt.es
LED modules eLED LINE 2 1350
Módulos LED eLED LINE 2 1350
eLED LINE
560mm
1350
R
6,1
1,6
Ø 4,7
2,8
18,4
24
15
125
125
30
125
125
15
560
~ LED Module appropriate for operation in constant current.
`*KIJNWOKPQWUGHſEKGPE[
~ Low heating of the module due to the independent operation of the
LED in low current.
~ Built-in luminaires.
Unidades por caja
7PKVURGTDQZ
Temp. máx. en la unión
/CZ6GOR+PVJGLWPEVKQP
Temp. funcionamiento
Flujo luminoso
típico a temp.
amb. 25 °C
1RGTCVKPIVGOR
Rango de Temp.
tensión de color
típica
Temp. máx. en tc
Intensidad
máxima
6[RKECN
NWOKPQWUƀWZ
CVCODVGOR
25 °C
/CZVGORCVVERQKPV
Potencia
típica en
módulo
Colour
temp.
CRI
Ref.
No.
6[RKECN
voltage
range
'ſEKGPEKCNWOKPQUCVÈRKEC
Modelo
/CZKOWO
current
6[RKECNNWOKPQWUGHſECE[
Model
6[RKECN
RQYGTKP
module
~ Módulo de LED apropiado para funcionamiento en corriente
constante.
`#NVCGſEKGPEKCNWOÈPKEC
~ Bajo calentamiento del módulo debido al funcionamiento
independiente del LED a baja corriente.
~ Instalación en luminaria.
W
mA
V
*K
*lm
lm / W
tc (°C)
ta (°C)
eLED LINE 2 1350 830
9950521
10,7
700
14,5… 16
3000
1265
118
>80
75
-40… +55
Tj (°C)
110
60
eLED LINE 2 1350 840
9950522
10,7
700
14,5… 16
4000
1350
126
>80
75
-40… +55
110
60
eLED LINE 2 1350 857
9950523
10,7
700
14,5… 16
5700
1385
130
>80
75
-40… +55
110
60
.WOKPQWUƀWZVQNGTCPEGvCPFHQTEQNQWTVGORGTCVWTGvIWCTCPVGGKPICUVCPFCTFFGXKCVKQPQHvRGTOQFWNGG.'&
Tolerancia de Flujo Luminoso de ±7% y de Temperatura de Color ±7% asegurando una desviación típica de un ±3% por módulo eLED
~ Beam angle 120°.
~ Color tolerance: 3 MacAdam’s ellipses - 3SDCM.
~ Excellent thermal performance, not require further dissipation
~ Dimmable.
~ Indifferent installation position.
~ Anti-reverse polarity protection.
~ Push wire connection.
~ The connector allows connection and disconnection.
~ Wire gauge: 0,2... 0,75 mm2.
~ Stripping length: 6...7 mm.
`.QPINKHGVKOGQHJQWTUCV6ENWOKPQWUƀWZQH CHVGT
this time period.
~ Angulo de visión 120°.
~ Tolerancia de color: 3 elipses de MacAdam - 3SDCM.
~ Bajo calentamiento del módulo, no requiere ningún tipo de
disipación extra.
~ Regulable.
~ Posición de la operación indiferente.
~ Protección contra inversión de polaridad.
~ Conexión mediante conector rápido.
~ Conector que permite conexión y desconexión.
~ Sección conductor: 0,2... 0,75 mm2.
~ Longitud de pelado: 6... 7 mm.
`.CTICXKFCFGJQTCUC6EEQPƀWLQNWOKPQUQ FGURWÃU
de este periodo.
~ Made in 5RCKP.
~ 5 years warranty in combination with an appropriate ELT driver.
~ Fabricado en España.
~ Garantía de 5 años en combinación con driver ELT apropiado.
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
2TQFWEVUGNGEVKQPRCICPFYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
Selección de producto pág. 51 y www.elt.es/productos/buscador_producto.html
RoHS
EN 62031 Safety / Seguridad
EN 62471 Photo-biological / Fotobiológica
www.elt.es
35
R
LUMINOUS FLUX DATA
Colour Temperature
Intensidad
Temperatura de Color
mA
700
500
350
Lumenes (lm)
Current
DATOS DEL FLUJO LUMINOSO
6[RKECNNWOKPQWUƀWZ
CVCODVGORu%
Flujo luminoso típico a
temp. amb. 25 °C
*K
*lm
3000
1265
4000
1350
5700
1385
3000
960
4000
1025
5700
1055
3000
700
4000
750
5700
770
1600
1400
1200
1000
3000K
Fi
4000K
Fi
Fi
5700K
800
600
400
200
300
.WOKPQWUƀWZVQNGTCPEGvCPFHQTEQNQWTVGORGTCVWTGv
IWCTCPVGGKPICUVCPFCTFFGXKCVKQPQHvRGTOQFWNGG.'&
Tolerancia de Flujo Luminoso de ±7% y de Temperatura de Color ±7%
asegurando una desviación típica de un ±3% por módulo eLED
350
400
450
500
550
600
650
700
……..
1050
Corriente (mA)
LED BIN SELECTION
ELECCIÓN DEL BIN DEL LED
Each eLED LINE is made with approved LED and selected
previously during our logistic process, considering brightness, colour and voltage, obtaining guaranteed uniformity
and quality of the light.
$TKIJVPGUU%JQKEGQH.'&UYKVJJKIJGHſEKGPE[VQGPUWTG
NWOGPUYCVVURGEKſGF
8QNVCIG Tolerance in each LED of maximum 0,1V.
%QNQWT The possible variation of LED colour is imperceptible to the human eye, and as a result gives 3
MacAdam’s ellipses: 3SDCM.
Cada eLED LINE se fabrica con LED previamente acordado y seleccionado en nuestro proceso logístico, en cuanto a
Brillo, Color y Tensión, de esta forma la uniformidad y calidad de la luz está garantizada.
Brillo: 'NGEEKÎP FG NQU .'&U EQP CNVQ PKXGN FG GſEKGPEKC
RCTCICTCPVK\CTNQUNÕOGPGUYCVKQGURGEKſECFQU
Tensión: Tolerancia en cada LED máxima de 0,1V.
Color: La posible variación de color de los LED es imperceptible al ojo humano, dando como resultado 3 elipses de
MacAdam: 3SDCM.
LUMINOUS INTENSITY DISTRIBUTION
CURVES (Cd/Klm) @700mA
CURVAS DE DISTRIBUCIÓN DE
INTENSIDAD LUMÍNICA (Cd/Klm) @700mA
This luminous intensity distribution curve is the result of
the information obtained with an unique eLED LINE module
without any type of optics.
Esta curva de distribución de intensidad lumínica es el resultado de los datos obtenidos de un único modulo eLED
LINE sin ningún tipo de óptica.
36
www.elt.es
R
EJEMPLOS DE COMBINACIONES
eLED LINE Y DRIVER ELT @700mA
1 x 1 eLED
+ SEC -
R
~ PRI ~
EXAMPLES OF COMBINATION
eLED LINE AND ELT DRIVER @700mA
R
R
DRIVER
{
1 x 2 eLED
+ SEC -
R
~ PRI ~
1
Driver LC 116/700-A
560 mm
1.350 Lm
15,25 Vout
10,7 W
R
R
R
R
1
2
R
R
R
R
DRIVER
R
L
N
R
R
3
R
2 x 560 = 1.120 mm
Driver LC 125/700-A
2 x 560 = 1.120 mm
2 x 1.350 = 2.700 Lm
2 x 15,25 = 30,50 Vout
2 x 10,7 = 21,4 W
2
1
R
{
DRIVER
4
2 x 2 eLED
{
1
R
R
1 x 560 = 560 mm
4 x 1 eLED
2
R
{
Driver LC 160/700-C
4 x 1.350 = 5.400 Lm
4 x 15,25 = 61 Vout
4 x 10,7 = 42,8 W
R
R
L
N
DRIVER
R
R
3
R
R
4
#UUGODN[CPF5CHGV[+PHQTOCVKQP
Información de instalación y de seguridad
The eLED LINE must be applied to dry and clean surfaces
that are free from dust, oil, silicone or other soiling.
'NOÎFWNQFGDGUGTKPUVCNCFQGPUWRGTſEKGUUGECU[NKOpias, libres de polvo, aceite, silicona u otra suciedad.
eLED LINE products are sensitive to mechanical efforts,
avoid applying mechanical tensions, bending stresses, millings, pressure, or any other form of mechanical stress on
them.
Los productos eLED LINE son sensibles a esfuerzos mecánicos, evite aplicar tensiones mecánicas, esfuerzos de
ƀGZKÎPHTGUCFQURTGUKÎPQEWCNSWKGTQVTCHQTOCFGGUVTÃU
mecánico.
eLED LINE modules should be taken by the edges of the
printed circuit board, never by the top side where the LED
components are.
Tome los módulos eLED LINE por los bordes del circuito
impreso, nunca sobre la cara top donde se sitúan los componentes LED.
Handle eLED LINE products in protected zones against
static electricity. (ESD Electric Static Discharge).
Manipule los productos eLED LINE en zonas protegidas
contra la electricidad estática. (ESD Electric Static Discharge).
A gap between consecutive modules is recommended to
facilitate the thermal expansion.
Se recomienda dejar una separación entre módulos consecutivos para favorecer las dilataciones.
0,5 mm
www.elt.es
37
LED modules eLED LINE 2 2100
Módulos LED eLED LINE 2 2100
1,6
R
6,1
4,5
Ø 4,7
31
40
29,5
110
110
61
110
110
29,5
560
~ LED Module appropriate for operation in constant current.
`*KIJNWOKPQWUGHſEKGPE[
~ Low voltage of the module, allowing applications up to more than
4.000lm with a voltage under 50V.
~ Low heating of the module due to the independent operation of the
LED in low current.
~ Built-in luminaires.
Unidades por caja
7PKVURGTDQZ
Temp. máx. en la unión
Temp. funcionamiento
Flujo luminoso
típico a temp.
amb. 25 °C
/CZ6GOR+PVJGLWPEVKQP
Rango de Temp.
tensión de color
típica
1RGTCVKPIVGOR
Intensidad
máxima
Temp. máx. en tc
Potencia
típica en
módulo
6[RKECN
NWOKPQWUƀWZ
CVCODVGOR
25 °C
/CZVGORCVVERQKPV
Ref.
No.
Colour
temp.
CRI
Modelo
/CZKOWO
current
6[RKECN
voltage
range
'ſEKGPEKCNWOKPQUCVÈRKEC
Model
6[RKECN
RQYGTKP
module
~ Módulo de LED apropiado para funcionamiento en corriente
constante.
`#NVCGſEKGPEKCNWOÈPKEC
~ Baja tensión del módulo lo que permite aplicaciones de hasta más
de 4.000lm con una tensión inferior a 50V.
~ Bajo calentamiento del módulo debido al funcionamiento
independiente del LED a baja corriente.
~ Instalación en luminaria.
6[RKECNNWOKPQWUGHſECE[
eLED LINE
560x40mm
2100
W
mA
V
*K
*lm
lm / W
tc (°C)
ta (°C)
eLED LINE 2 2100 830
9950526
17,1
700
23,2… 25,6
3000
1970
115
>80
75
-40… +55
Tj (°C)
110
40
eLED LINE 2 2100 840
9950527
17,1
700
23,2… 25,6
4000
2100
123
>80
75
-40… +55
110
40
eLED LINE 2 2100 857
9950528
17,1
700
23,2… 25,6
5700
2160
126
>80
75
-40… +55
110
40
.WOKPQWUƀWZVQNGTCPEGvCPFHQTEQNQWTVGORGTCVWTGvIWCTCPVGGKPICUVCPFCTFFGXKCVKQPQHvRGTOQFWNGG.'&
Tolerancia de Flujo Luminoso de ±7% y de Temperatura de Color ±7% asegurando una desviación típica de un ±3% por módulo eLED
~ Beam angle 120°.
~ Color tolerance: 3 MacAdam’s ellipses - 3SDCM.
~ Excellent thermal performance, not require further dissipation
~ Dimmable.
~ Indifferent installation position.
~ Anti-reverse polarity protection.
~ Designed upon ZHAGA requirements book 7 cat. LLE-L56W4.
~ Push wire connection.
~ The connector allows connection and disconnection.
~ Wire gauge: 0,2... 0,75 mm2.
~ Stripping length: 6...7 mm.
`.QPINKHGVKOGQHJQWTUCV6ENWOKPQWUƀWZQH CHVGT
this time period.
~ Angulo de visión 120°.
~ Tolerancia de color: 3 elipses de MacAdam - 3SDCM.
~ Bajo calentamiento del módulo, no requiere ningún tipo de
disipación extra.
~ Regulable.
~ Posición de la operación indiferente.
~ Protección contra inversión de polaridad.
~ Diseñado bajo requerimientos ZHAGA libro 7 cat. LLE-L56E4.
~ Conexión mediante conector rápido.
~ Conector que permite conexión y desconexión.
~ Sección conductor: 0,2... 0,75 mm2.
~ Longitud de pelado: 6... 7 mm.
`.CTICXKFCFGJQTCUC6EEQPƀWLQNWOKPQUQ FGURWÃU
de este periodo.
~ Made in 5RCKP.
~ 5 years warranty in combination with an appropriate ELT driver.
~ Fabricado en España.
~ Garantía de 5 años en combinación con driver ELT apropiado.
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
2TQFWEVUGNGEVKQPRCICPFYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
Selección de producto pág. 51 y www.elt.es/productos/buscador_producto.html
RoHS
EN 62031 Safety / Seguridad
EN 62471 Photo-biological / Fotobiológica
38
www.elt.es
R
LUMINOUS FLUX DATA
Colour Temperature
Intensidad
Temperatura de Color
mA
700
500
350
Lumenes (lm)
Current
DATOS DEL FLUJO LUMINOSO
6[RKECNNWOKPQWUƀWZ
CVCODVGORu%
Flujo luminoso típico a
temp. amb. 25 °C
*K
*lm
3000
1970
4000
2100
5700
2160
3000
1540
4000
1640
5700
1685
3000
1120
4000
1200
5700
1230
2700
2200
1700
Fila 3000K
3
Fila 4000K
4
Fila 5700K
5
1200
700
200
300
.WOKPQWUƀWZVQNGTCPEGvCPFHQTEQNQWTVGORGTCVWTGv
IWCTCPVGGKPICUVCPFCTFFGXKCVKQPQHvRGTOQFWNGG.'&
Tolerancia de Flujo Luminoso de ±7% y de Temperatura de Color ±7%
asegurando una desviación típica de un ±3% por módulo eLED
350
400
450
500
550
600
650
700
…….. 1050
Corriente (mA)
LED BIN SELECTION
ELECCIÓN DEL BIN DEL LED
Each eLED LINE is made with approved LED and selected
previously during our logistic process, considering brightness, colour and voltage, obtaining guaranteed uniformity
and quality of the light.
$TKIJVPGUU%JQKEGQH.'&UYKVJJKIJGHſEKGPE[VQGPUWTG
NWOGPUYCVVURGEKſGF
8QNVCIG Tolerance in each LED of maximum 0,1V.
%QNQWT The possible variation of LED colour is imperceptible to the human eye, and as a result gives 3
MacAdam’s ellipses: 3SDCM.
Cada eLED LINE se fabrica con LED previamente acordado y seleccionado en nuestro proceso logístico, en cuanto a
Brillo, Color y Tensión, de esta forma la uniformidad y calidad de la luz está garantizada.
Brillo: 'NGEEKÎP FG NQU .'&U EQP CNVQ PKXGN FG GſEKGPEKC
RCTCICTCPVK\CTNQUNÕOGPGUYCVKQGURGEKſECFQU
Tensión: Tolerancia en cada LED máxima de 0,1V.
Color: La posible variación de color de los LED es imperceptible al ojo humano, dando como resultado 3 elipses de
MacAdam: 3SDCM.
LUMINOUS INTENSITY DISTRIBUTION
CURVES (Cd/Klm) @700mA
CURVAS DE DISTRIBUCIÓN DE
INTENSIDAD LUMÍNICA (Cd/Klm) @700mA
This luminous intensity distribution curve is the result of
the information obtained with an unique eLED LINE module
without any type of optics.
Esta curva de distribución de intensidad lumínica es el resultado de los datos obtenidos de un único modulo eLED
LINE sin ningún tipo de óptica.
www.elt.es
39
R
~ PRI ~
EJEMPLOS DE COMBINACIONES
eLED LINE Y DRIVER ELT @700mA
1 x 1 eLED
+ SEC -
R
Made in Spain (EU)
EXAMPLES OF COMBINATION
eLED LINE AND ELT DRIVER @700mA
R
R
DRIVER
1
{
Driver LC 125/700-A
560 mm
2.100 Lm
24,4 Vout
17,1 W
R
DRIVER
L
N
R
R
R
R
1
2
1 x 2 eLED
{
1
2
R
R
Made in Spain (EU)
L
N
DRIVER
R
2 x 560 = 1.120 mm
R
R
R
R
Driver LC 142/700-C
2 x 560 = 1.120 mm
2 x 2.100 = 4.200 Lm
2 x 24,4 = 48,4 Vout
2 x 17,1 = 34,2 W
R
R
4
3
2 x 2 eLED
{
1
R
R
1 x 560 = 560 mm
4 x 1 eLED
2
R
{
Driver LC 190/700-D
4 x 2.100 = 8.400 Lm
4 x 24,4 = 97,6 Vout
4 x 17,1 = 68,4 W
R
R
Made in Spain (EU)
L
N
DRIVER
R
R
3
R
R
4
#UUGODN[CPF5CHGV[+PHQTOCVKQP
Información de instalación y de seguridad
The eLED LINE must be applied to dry and clean surfaces
that are free from dust, oil, silicone or other soiling.
'NOÎFWNQFGDGUGTKPUVCNCFQGPUWRGTſEKGUUGECU[NKOpias, libres de polvo, aceite, silicona u otra suciedad.
eLED LINE products are sensitive to mechanical efforts,
avoid applying mechanical tensions, bending stresses, millings, pressure, or any other form of mechanical stress on
them.
Los productos eLED LINE son sensibles a esfuerzos mecánicos, evite aplicar tensiones mecánicas, esfuerzos de
ƀGZKÎPHTGUCFQURTGUKÎPQEWCNSWKGTQVTCHQTOCFGGUVTÃU
mecánico.
eLED LINE modules should be taken by the edges of the
printed circuit board, never by the top side where the LED
components are.
Tome los módulos eLED LINE por los bordes del circuito
impreso, nunca sobre la cara top donde se sitúan los componentes LED.
Handle eLED LINE products in protected zones against
static electricity. (ESD Electric Static Discharge).
Manipule los productos eLED LINE en zonas protegidas
contra la electricidad estática. (ESD Electric Static Discharge).
A gap between consecutive modules is recommended to
facilitate the thermal expansion.
Se recomienda dejar una separación entre módulos consecutivos para favorecer las dilataciones.
0,5 mm
40
www.elt.es
R
ACCESSORIES
ACCESORIOS
ADHESIVE TAPE
+P ECUG C ſZCVKQP
ſZKPI QH VJG G.'& .+0' KU YKUJGF D[
means of adhesive tape, we recommend the utilization of the
tape 3M™ VHB ™ Covers RP25 (F).
CINTA ADHESIVA
'PGNECUQFGSWGUGFGUGGWPCſLCEKÎPFGNQUG.'&.+0'
mediante cinta adhesiva, recomendamos la utilización de la
cinta 3M™ VHB™ Tape RP25 (F).
Las cintas VHB™ se han sometido a gran número de envejecimientos acelerados en cámara climática, incluyendo
exposiciones a altas y bajas temperaturas, humedad y radiación ultravioleta, manteniendo muy aceptablemente las
propiedades de adhesión.
The VHB™ tapes have been subjected to accelerated
aging tests in a climatic chamber, including high and low
temperature exposures, humidity and UV radiation, keeping
well their adhesion properties.
Example of test: 92% of adhesion after an aging test at
70°C during 5 years.
Ejemplo de ensayo: 92% de su adhesión después de un
envejecimiento a 70°C durante 5 años.
Model
Code
&KOGPUKQPU
6JKEMPGUU
Modelo
Código
Dimensiones
Espesor
eLED LINE 1 800
9730001
278x15 mm
0,6mm
eLED LINE 1 1100
9730002
278x25 mm
0,6mm
eLED LINE 2 1350
9730003
558x15 mm
0,6mm
eLED LINE 2 2100
9730004
558x25 mm
0,6mm
RECOMMENDATIONS FOR USE:
RECOMENDACIONES DE USO:
For maximum bond strength the surfaces should be thoroughly cleaned with a 50:50 mixture of isopropyl alcohol and
water.
5GFGDGNKORKCTNCUUWRGTſEKGUEQPWPCOG\ENCCNFG
alcohol isopropílico y agua.
La aplicación de la cinta debe realizarse en condiciones
ambientales de temperatura entre 21°C y 38°C. No se recomienda la aplicación a temperaturas inferiores a 10°C.
Application must be accomplished when temperature is
between 21°C and 38°C. Initial tape application to surfaces
at temperatures below 10°C is not recommended.
Almacenar en su embalaje original, en lugar seco y a temperatura controlada entre 15-25°C. En estas condiciones se
conservan sus propiedades durante un periodo mínimo de 1
CÌQ'UVQPQUKIPKſECSWGNCEKPVCUGFGITCFGVCPUQNQVKGPG
que ver con el protector siliconado. Una vez aplicado el producto, 3M garantiza una vida superior a 10 años.
Must be stored in original cartons in a dry place and the
temperature must be controlled between 15-25°C. In these
conditions its properties keep on for a minimum period of
1 year. It doesn’t mean that the tape will degenerate; it is
related to his silicone protector. Once the product is applied,
3M guarantees a lifetime superior to 10 years.
&CFC NC XCTKGFCF FG UWRGTſEKGU FG CRNKECEKÎP GN WUQ [
rendimiento del producto debe ser testado por el usuario
para conocer su aptitud para el propósito deseado.
Given the surfaces variety of application, the use and performance of the product must be tested by the user in order
to know his aptitude for the intended purpose.
www.elt.es
41
LED modules eLED OCTO 1 1850
Módulos LED eLED OCTO 1 1850
62
38
R
1,6
Ø 125
3 x 120º
Ø4
R
50
Ø7
8
R
152,44
6,1
58
Ø 162
24
~ LED Module appropriate for operation in constant current.
`*KIJNWOKPQWUGHſEKGPE[
~ Low heating of the module due to the independent operation of the
LED in low current.
~ Built-in luminaires.
Unidades por caja
7PKVURGTDQZ
Temp. máx. en la unión
/CZ6GOR+PVJGLWPEVKQP
Temp. funcionamiento
1RGTCVKPIVGOR
Temp. máx. en tc
CRI
/CZVGORCVVERQKPV
Rango de
tensión
típica
'ſEKGPEKCNWOKPQUCVÈRKEC
Intensidad
máxima
6[RKECNNWOKPQWUGHſECE[
Potencia
típica en
módulo
Flujo luminoso típico a temp.
amb. 25 °C
Ref.
No.
6[RKECN
voltage
range
Temp. de color
Modelo
/CZKOWO
current
6[RKECNNWOKPQWUƀWZCV
CODVGORu%
Model
6[RKECN
RQYGTKP
module
~ Módulo de LED apropiado para funcionamiento en corriente
constante.
`#NVCGſEKGPEKCNWOÈPKEC
~ Bajo calentamiento del módulo debido al funcionamiento
independiente del LED a baja corriente.
~ Instalación en luminaria.
Colour temp.
eLED
OCTO
Ø165mm
1850
W
mA
V
*K
*lm
lm / W
tc (°C)
ta (°C)
eLED OCTO 1 1850 830
9950551
15
700
20,3… 22,4
3000
1735
116
>80
75
-40… +55
Tj (°C)
110
30
eLED OCTO 1 1850 840
9950552
15
700
20,3… 22,4
4000
1850
123
>80
75
-40… +55
110
30
eLED OCTO 1 1850 857
9950553
15
700
20,3… 22,4
5700
1900
127
>80
75
-40… +55
110
30
.WOKPQWUƀWZVQNGTCPEGvCPFHQTEQNQWTVGORGTCVWTGvIWCTCPVGGKPICUVCPFCTFFGXKCVKQPQHvRGTOQFWNGG.'&
Tolerancia de Flujo Luminoso de ±7% y de Temperatura de Color ±7% asegurando una desviación típica de un ±3% por módulo eLED
~ Beam angle 120°.
~ Color tolerance: 3 MacAdam’s ellipses - 3SDCM.
~ Excellent thermal performance, not require further dissipation
~ Dimmable.
~ Indifferent installation position.
~ Anti-reverse polarity protection.
~ Push wire connection.
~ The connector allows connection and disconnection.
~ Wire gauge: 0,2... 0,75 mm2.
~ Stripping length: 6...7 mm.
`.QPINKHGVKOGQHJQWTUCV6ENWOKPQWUƀWZQH CHVGT
this time period.
~ Angulo de visión 120°.
~ Tolerancia de color: 3 elipses de MacAdam - 3SDCM.
~ Bajo calentamiento del módulo, no requiere ningún tipo de
disipación extra.
~ Regulable.
~ Posición de la operación indiferente.
~ Protección contra inversión de polaridad.
~ Conexión mediante conector rápido.
~ Conector que permite conexión y desconexión.
~ Sección conductor: 0,2... 0,75 mm2.
~ Longitud de pelado: 6... 7 mm.
`.CTICXKFCFGJQTCUC6EEQPƀWLQNWOKPQUQ FGURWÃU
de este periodo.
~ Made in 5RCKP.
~ 5 years warranty in combination with an appropriate ELT driver.
~ Fabricado en España.
~ Garantía de 5 años en combinación con driver ELT apropiado.
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
2TQFWEVUGNGEVKQPRCICPFYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
Selección de producto pág. 51 y www.elt.es/productos/buscador_producto.html
RoHS
EN 62031 Safety / Seguridad
EN 62471 Photo-biological / Fotobiológica
42
www.elt.es
R
LUMINOUS FLUX DATA
DATOS DEL FLUJO LUMINOSO
Lumenes (lm)
6[RKECNNWOKPQWUƀWZ
CVCODVGORu%
Current
Colour Temperature
Intensidad
Temperatura de Color
Flujo luminoso típico a
temp. amb. 25 °C
mA
*K
*lm
3000
1735
4000
1850
2000
1800
1600
1400
700
500
350
5700
1900
3000
1345
4000
1435
5700
1475
3000
980
4000
1045
5700
1075
1200
Fila 3000K
3
Fila 4000K
4
Fila 5700K
5
1000
800
600
400
200
300
.WOKPQWUƀWZVQNGTCPEGvCPFHQTEQNQWTVGORGTCVWTGv
IWCTCPVGGKPICUVCPFCTFFGXKCVKQPQHvRGTOQFWNGG.'&
Tolerancia de Flujo Luminoso de ±7% y de Temperatura de Color ±7%
asegurando una desviación típica de un ±3% por módulo eLED
350
400
450
500
550
600
650
700
…….. 1050
Corriente (mA)
LED BIN SELECTION
ELECCIÓN DEL BIN DEL LED
Each eLED OCTO is made with approved LED and selected previously during our logistic process, considering brightness, colour and voltage, obtaining guaranteed uniformity
and quality of the light.
$TKIJVPGUU%JQKEGQH.'&UYKVJJKIJGHſEKGPE[VQGPUWTG
NWOGPUYCVVURGEKſGF
8QNVCIG Tolerance in each LED of maximum 0,1V.
%QNQWT The possible variation of LED colour is imperceptible to the human eye, and as a result gives 3
MacAdam’s ellipses: 3SDCM.
Cada eLED OCTO se fabrica con LED previamente acordado y seleccionado en nuestro proceso logístico, en cuanto
a Brillo, Color y Tensión, de esta forma la uniformidad y calidad de la luz está garantizada.
Brillo: 'NGEEKÎP FG NQU .'&U EQP CNVQ PKXGN FG GſEKGPEKC
RCTCICTCPVK\CTNQUNÕOGPGUYCVKQGURGEKſECFQU
Tensión: Tolerancia en cada LED máxima de 0,1V.
Color: La posible variación de color de los LED es imperceptible al ojo humano, dando como resultado 3 elipses de
MacAdam: 3SDCM.
LUMINOUS INTENSITY DISTRIBUTION
CURVES (Cd/Klm) @700mA
CURVAS DE DISTRIBUCIÓN DE
INTENSIDAD LUMÍNICA (Cd/Klm) @700mA
This luminous intensity distribution curve is the result of
the information obtained with an unique eLED OCTO module
without any type of optics.
Esta curva de distribución de intensidad lumínica es el resultado de los datos obtenidos de un único modulo eLED
OCTO sin ningún tipo de óptica.
www.elt.es
43
R
EXAMPLES OF COMBINATION
eLED OCTO AND ELT DRIVER @700mA
EJEMPLOS DE COMBINACIONES
eLED OCTO Y DRIVER ELT @700mA
R
R
Made in Spain (EU)
R
+ SEC -
1 x 1 eLED
~ PRI ~
{
Driver LC 116/700-A
1.850 Lm
21,35 Vout
15 W
{
Driver LC 150/700-E
2 x 1.850 = 3.700 Lm
2 x 21,35 = 42,7 Vout
2 x 15 = 30 W
R
2 x 1 eLED
R
R
R
R
#UUGODN[CPF5CHGV[+PHQTOCVKQP
Información de instalación y de seguridad
The eLED OCTO must be applied to dry and clean surfaces that are free from dust, oil, silicone or other soiling.
'NOÎFWNQFGDGUGTKPUVCNCFQGPUWRGTſEKGUUGECU[NKOpias, libres de polvo, aceite, silicona u otra suciedad.
eLED OCTO products are sensitive to mechanical efforts,
avoid applying mechanical tensions, bending stresses, millings, pressure, or any other form of mechanical stress on
them.
Los productos eLED OCTO son sensibles a esfuerzos
mecánicos, evite aplicar tensiones mecánicas, esfuerzos de
ƀGZKÎPHTGUCFQURTGUKÎPQEWCNSWKGTQVTCHQTOCFGGUVTÃU
mecánico.
eLED OCTO modules should be taken by the edges of the
printed circuit board, never by the top side where the LED
components are.
Tome los módulos eLED OCTO por los bordes del circuito
impreso, nunca sobre la cara top donde se sitúan los componentes LED.
Handle eLED OCTO products in protected zones against
static electricity. (ESD Electric Static Discharge).
Manipule los productos eLED OCTO en zonas protegidas
contra la electricidad estática. (ESD Electric Static Discharge).
A gap between consecutive modules is recommended to
facilitate the thermal expansion.
Se recomienda dejar una separación entre módulos consecutivos para favorecer las dilataciones.
44
www.elt.es
LED modules eLED OCTO 1 2250
Módulos LED eLED OCTO 1 2250
62
38
eLED
OCTO
Ø165mm
2250
R
1,6
Ø 125
3 x 120º
Ø4
R
50
Ø7
R
8
152,44
6,1
58
Ø 162
24
~ LED Module appropriate for operation in constant current.
`*KIJNWOKPQWUGHſEKGPE[
~ Low heating of the module due to the independent operation of the
LED in low current.
~ Built-in luminaires.
Unidades por caja
7PKVURGTDQZ
Temp. máx. en la unión
/CZ6GOR+PVJGLWPEVKQP
Temp. funcionamiento
1RGTCVKPIVGOR
Temp. máx. en tc
/CZVGORCVVERQKPV
CRI
'ſEKGPEKCNWOKPQUCVÈRKEC
Rango de
tensión
típica
6[RKECNNWOKPQWUGHſECE[
Intensidad
máxima
Flujo luminoso típico a temp.
amb. 25 °C
Potencia
típica en
módulo
Temp. de color
Ref.
No.
6[RKECN
voltage
range
6[RKECNNWOKPQWUƀWZCV
CODVGORu%
Modelo
/CZKOWO
current
Colour temp.
Model
6[RKECN
RQYGTKP
module
~ Módulo de LED apropiado para funcionamiento en corriente
constante.
`#NVCGſEKGPEKCNWOÈPKEC
~ Bajo calentamiento del módulo debido al funcionamiento
independiente del LED a baja corriente.
~ Instalación en luminaria.
W
mA
V
*K
*lm
lm / W
tc (°C)
ta (°C)
eLED OCTO 1 2250 830
9950556
19,5
700
26,1… 28,8
3000
2120
109
>80
75
-40… +55
Tj (°C)
110
30
eLED OCTO 1 2250 840
9950557
19,5
700
26,1… 28,8
4000
2250
115
>80
75
-40… +55
110
30
eLED OCTO 1 2250 857
9950558
19,5
700
26,1… 28,8
5700
2315
119
>80
75
-40… +55
110
30
.WOKPQWUƀWZVQNGTCPEGvCPFHQTEQNQWTVGORGTCVWTGvIWCTCPVGGKPICUVCPFCTFFGXKCVKQPQHvRGTOQFWNGG.'&
Tolerancia de Flujo Luminoso de ±7% y de Temperatura de Color ±7% asegurando una desviación típica de un ±3% por módulo eLED
~ Beam angle 120°.
~ Color tolerance: 3 MacAdam’s ellipses - 3SDCM.
~ Excellent thermal performance, not require further dissipation
~ Dimmable.
~ Indifferent installation position.
~ Anti-reverse polarity protection.
~ Push wire connection.
~ The connector allows connection and disconnection.
~ Wire gauge: 0,2... 0,75 mm2.
~ Stripping length: 6...7 mm.
`.QPINKHGVKOGQHJQWTUCV6ENWOKPQWUƀWZQH CHVGT
this time period.
~ Angulo de visión 120°.
~ Tolerancia de color: 3 elipses de MacAdam - 3SDCM.
~ Bajo calentamiento del módulo, no requiere ningún tipo de
disipación extra.
~ Regulable.
~ Posición de la operación indiferente.
~ Protección contra inversión de polaridad.
~ Conexión mediante conector rápido.
~ Conector que permite conexión y desconexión.
~ Sección conductor: 0,2... 0,75 mm2.
~ Longitud de pelado: 6... 7 mm.
`.CTICXKFCFGJQTCUC6EEQPƀWLQNWOKPQUQ FGURWÃU
de este periodo.
~ Made in 5RCKP.
~ 5 years warranty in combination with an appropriate ELT driver.
~ Fabricado en España.
~ Garantía de 5 años en combinación con driver ELT apropiado.
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
2TQFWEVUGNGEVKQPRCICPFYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
Selección de producto pág. 51 y www.elt.es/productos/buscador_producto.html
RoHS
EN 62031 Safety / Seguridad
EN 62471 Photo-biological / Fotobiológica
www.elt.es
45
R
LUMINOUS FLUX DATA
Colour Temperature
Intensidad
Temperatura de Color
mA
700
500
350
Lumenes (lm)
Current
DATOS DEL FLUJO LUMINOSO
6[RKECNNWOKPQWUƀWZ
CVCODVGORu%
2200
Flujo luminoso típico a
temp. amb. 25 °C
*K
*lm
3000
2120
4000
2250
5700
2315
3000
1620
4000
1725
5700
1775
3000
1180
4000
1260
5700
1295
2700
1700
3000K
Fila
15
4000K
Fila
16
Fila
17
5700K
1200
700
200
300
350
400
Corriente (mA)
.WOKPQWUƀWZVQNGTCPEGvCPFHQTEQNQWTVGORGTCVWTGv
IWCTCPVGGKPICUVCPFCTFFGXKCVKQPQHvRGTOQFWNGG.'&
Tolerancia de Flujo Luminoso de ±7% y de Temperatura de Color ±7%
asegurando una desviación típica de un ±3% por módulo eLED
450
500
550
600
650
700
……..
900
LED BIN SELECTION
ELECCIÓN DEL BIN DEL LED
Each eLED OCTO is made with approved LED and selected previously during our logistic process, considering brightness, colour and voltage, obtaining guaranteed uniformity
and quality of the light.
$TKIJVPGUU%JQKEGQH.'&UYKVJJKIJGHſEKGPE[VQGPUWTG
NWOGPUYCVVURGEKſGF
8QNVCIG Tolerance in each LED of maximum 0,1V.
%QNQWT The possible variation of LED colour is imperceptible to the human eye, and as a result gives 3
MacAdam’s ellipses: 3SDCM.
Cada eLED OCTO se fabrica con LED previamente acordado y seleccionado en nuestro proceso logístico, en cuanto
a Brillo, Color y Tensión, de esta forma la uniformidad y calidad de la luz está garantizada.
Brillo: 'NGEEKÎP FG NQU .'&U EQP CNVQ PKXGN FG GſEKGPEKC
RCTCICTCPVK\CTNQUNÕOGPGUYCVKQGURGEKſECFQU
Tensión: Tolerancia en cada LED máxima de 0,1V.
Color: La posible variación de color de los LED es imperceptible al ojo humano, dando como resultado 3 elipses de
MacAdam: 3SDCM.
LUMINOUS INTENSITY DISTRIBUTION
CURVES (Cd/Klm) @700mA
CURVAS DE DISTRIBUCIÓN DE
INTENSIDAD LUMÍNICA (Cd/Klm) @700mA
This luminous intensity distribution curve is the result of
the information obtained with an unique eLED OCTO module
without any type of optics.
Esta curva de distribución de intensidad lumínica es el resultado de los datos obtenidos de un único modulo eLED
OCTO sin ningún tipo de óptica.
46
www.elt.es
R
EXAMPLES OF COMBINATIONS
eLED OCTO AND ELT DRIVER @700mA
EJEMPLOS DE COMBINACIONES
eLED OCTO Y DRIVER ELT @700mA
R
R
Made in Spain (EU)
R
+ SEC -
1 x 1 eLED
~ PRI ~
{
Driver LC 125/700-A
2.250 Lm
27,9 Vout
19,5 W
{
Driver LC 150/700-E
2 x 2.250 = 4.500 Lm
2 x 27,9 = 55,8 Vout
2 x 19,5 = 39 W
R
R
R
2 x 1 eLED
R
R
#UUGODN[CPF5CHGV[+PHQTOCVKQP
Información de instalación y de seguridad
The eLED OCTO must be applied to dry and clean surfaces that are free from dust, oil, silicone or other soiling.
'NOÎFWNQFGDGUGTKPUVCNCFQGPUWRGTſEKGUUGECU[NKOpias, libres de polvo, aceite, silicona u otra suciedad.
eLED OCTO products are sensitive to mechanical efforts,
avoid applying mechanical tensions, bending stresses, millings, pressure, or any other form of mechanical stress on
them.
Los productos eLED OCTO son sensibles a esfuerzos
mecánicos, evite aplicar tensiones mecánicas, esfuerzos de
ƀGZKÎPHTGUCFQURTGUKÎPQEWCNSWKGTQVTCHQTOCFGGUVTÃU
mecánico.
eLED OCTO modules should be taken by the edges of the
printed circuit board, never by the top side where the LED
components are.
Tome los módulos eLED OCTO por los bordes del circuito
impreso, nunca sobre la cara top donde se sitúan los componentes LED.
Handle eLED OCTO products in protected zones against
static electricity. (ESD Electric Static Discharge).
Manipule los productos eLED OCTO en zonas protegidas
contra la electricidad estática. (ESD Electric Static Discharge).
A gap between consecutive modules is recommended to
facilitate the thermal expansion.
www.elt.es
Se recomienda dejar una separación entre módulos consecutivos para favorecer las dilataciones.
47
LED modules eLED SQUARE 2 1700
Módulos LED eLED SQUARE 2 1700
R
6,1
Ø 4,7
R
R
205,6
250
1,6
~ LED Module appropriate for operation in constant current.
`*KIJNWOKPQWUGHſEKGPE[
~ Low heating of the module due to the independent operation of the
LED in low current.
~ Built-in luminaires.
Unidades por caja
7PKVURGTDQZ
Temp. máx. en la unión
/CZ6GOR+PVJGLWPEVKQP
Temp. funcionamiento
1RGTCVKPIVGOR
Temp. máx. en tc
CRI
Rango de
tensión
típica
/CZVGORCVVERQKPV
Intensidad
máxima
'ſEKGPEKCNWOKPQUCVÈRKEC
Potencia
típica en
módulo
6[RKECNNWOKPQWUGHſECE[
Ref.
No.
6[RKECN
voltage
range
Flujo luminoso típico a temp.
amb. 25 °C
Modelo
/CZKOWO
current
Temp. de color
Model
6[RKECN
RQYGTKP
module
~ Módulo de LED apropiado para funcionamiento en corriente
constante.
`#NVCGſEKGPEKCNWOÈPKEC
~ Bajo calentamiento del módulo debido al funcionamiento
independiente del LED a baja corriente.
~ Instalación en luminaria.
6[RKECNNWOKPQWUƀWZCV
CODVGORu%
250 166,7
Colour temp.
eLED
SQUARE
250mm
1700
W
mA
V
*K
*lm
lm / W
tc (°C)
ta (°C)
eLED SQUARE 2 1700 830
9950541
12,8
700
17,4… 19,2
3000
1595
125
>80
75
-40… +55
Tj (°C)
110
30
eLED SQUARE 2 1700 840
9950542
12,8
700
17,4… 19,2
4000
1700
133
>80
75
-40… +55
110
30
eLED SQUARE 2 1700 857
9950543
12,8
700
17,4… 19,2
5700
1750
137
>80
75
-40… +55
110
30
OPERATING MODE AT 500mA / MODO DE FUNCIONAMIENTO A 500mA
eLED SQUARE 2 1700 830
9950541
9,2
500
17,4… 19,2
3000
1220
133
>80
75
-40… +55
110
30
eLED SQUARE 2 1700 840
9950542
9,2
500
17,4… 19,2
4000
1300
142
>80
75
-40… +55
110
30
eLED SQUARE 2 1700 857
9950543
9,2
500
17,4… 19,2
5700
1335
146
>80
75
-40… +55
110
30
.WOKPQWUƀWZVQNGTCPEGvCPFHQTEQNQWTVGORGTCVWTGvIWCTCPVGGKPICUVCPFCTFFGXKCVKQPQHvRGTOQFWNGG.'&
Tolerancia de Flujo Luminoso de ±7% y de Temperatura de Color ±7% asegurando una desviación típica de un ±3% por módulo eLED
~ Beam angle 120°.
~ Color tolerance: 3 MacAdam’s ellipses - 3SDCM.
~ Excellent thermal performance, not require further dissipation
~ Dimmable.
~ Indifferent installation position.
~ Anti-reverse polarity protection.
~ Push wire connection.
~ The connector allows connection and disconnection.
~ Wire gauge: 0,2... 0,75 mm2.
~ Stripping length: 6...7 mm.
`.QPINKHGVKOGQHJQWTUCV6ENWOKPQWUƀWZQH CHVGT
this time period.
~ Angulo de visión 120°.
~ Tolerancia de color: 3 elipses de MacAdam - 3SDCM.
~ Bajo calentamiento del módulo, no requiere ningún tipo de
disipación extra.
~ Regulable.
~ Posición de la operación indiferente.
~ Protección contra inversión de polaridad.
~ Conexión mediante conector rápido.
~ Conector que permite conexión y desconexión.
~ Sección conductor: 0,2... 0,75 mm2.
~ Longitud de pelado: 6... 7 mm.
`.CTICXKFCFGJQTCUC6EEQPƀWLQNWOKPQUQ FGURWÃU
de este periodo.
~ Made in 5RCKP.
~ 5 years warranty in combination with an appropriate ELT driver.
~ Fabricado en España.
~ Garantía de 5 años en combinación con driver ELT apropiado.
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
2TQFWEVUGNGEVKQPRCICPFYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
Selección de producto pág. 51 y www.elt.es/productos/buscador_producto.html
RoHS
EN 62031 Safety / Seguridad
EN 62471 Photo-biological / Fotobiológica
48
www.elt.es
R
LUMINOUS FLUX DATA
DATOS DEL FLUJO LUMINOSO
Lumenes (lm)
6[RKECNNWOKPQWUƀWZ
CVCODVGORu%
Current
Colour Temperature
Intensidad
Temperatura de Color
Flujo luminoso típico a
temp. amb. 25 °C
mA
*K
*lm
3000
1595
4000
1700
2000
1800
1600
1400
700
500
5700
1750
3000
1220
4000
1300
5700
1335
1200
3000K
Fila
3
4000K
Fila
4
Fila
5
5700K
1000
800
600
.WOKPQWUƀWZVQNGTCPEGvCPFHQTEQNQWTVGORGTCVWTGv
IWCTCPVGGKPICUVCPFCTFFGXKCVKQPQHvRGTOQFWNGG.'&
Tolerancia de Flujo Luminoso de ±7% y de Temperatura de Color ±7%
asegurando una desviación típica de un ±3% por módulo eLED
400
200
400
450
500
550
600
650
700
……..
1050
Corriente (mA)
LED BIN SELECTION
ELECCIÓN DEL BIN DEL LED
Each eLED SQUARE is made with approved LED and
selected previously during our logistic process, considering
brightness, colour and voltage, obtaining guaranteed uniformity and quality of the light.
$TKIJVPGUU%JQKEGQH.'&UYKVJJKIJGHſEKGPE[VQGPUWTG
NWOGPUYCVVURGEKſGF
8QNVCIG Tolerance in each LED of maximum 0,1V.
%QNQWT The possible variation of LED colour is imperceptible to the human eye, and as a result gives 3
MacAdam’s ellipses: 3SDCM.
Cada eLED SQUARE se fabrica con LED previamente
acordado y seleccionado en nuestro proceso logístico, en
cuanto a Brillo, Color y Tensión, de esta forma la uniformidad y calidad de la luz está garantizada.
Brillo: 'NGEEKÎP FG NQU .'&U EQP CNVQ PKXGN FG GſEKGPEKC
RCTCICTCPVK\CTNQUNÕOGPGUYCVKQGURGEKſECFQU
Tensión: Tolerancia en cada LED máxima de 0,1V.
Color: La posible variación de color de los LED es imperceptible al ojo humano, dando como resultado 3 elipses de
MacAdam: 3SDCM.
LUMINOUS INTENSITY DISTRIBUTION
CURVES (Cd/Klm) @700mA
CURVAS DE DISTRIBUCIÓN DE
INTENSIDAD LUMÍNICA (Cd/Klm) @700mA
This luminous intensity distribution curve is the result of
the information obtained with an unique eLED SQUARE
module without any type of optics.
Esta curva de distribución de intensidad lumínica es el resultado de los datos obtenidos de un único modulo eLED
SQUARE sin ningún tipo de óptica.
www.elt.es
49
R
R
~ PRI ~
EJEMPLOS DE COMBINACIONES
eLED SQUARE Y DRIVER ELT @700mA
+ SEC -
Made in Spain (EU)
EXAMPLES OF COMBINATION
eLED SQUARE AND ELT DRIVER @700mA
DRIVER
R
R
R
R
1 x 1 eLED
{
Driver LC 116/700-A
1.700 Lm
18,3 Vout
12,8 W
R
DRIVER
R
R
R
R
R
4 x 1 eLED
R
L
N
2 x 1 eLED
DRIVER
R
R
{
Driver LC 142/700-C
2 x 1.700 = 3.400 Lm
2 x 18,3 = 36,6 Vout
2 x 12,8 = 25,6 W
{
Driver LC 160/700-C
4 x 1.700 = 6.800 Lm
4 x 18,3 = 73,2 Vout
4 x 12,8 = 51,2 W
R
L
N
R
R
#UUGODN[CPF5CHGV[+PHQTOCVKQP
Información de instalación y de seguridad
The eLED SQUARE must be applied to dry and clean surfaces that are free from dust, oil, silicone or other soiling.
'NOÎFWNQFGDGUGTKPUVCNCFQGPUWRGTſEKGUUGECU[NKOpias, libres de polvo, aceite, silicona u otra suciedad.
eLED SQUARE products are sensitive to mechanical efforts, avoid applying mechanical tensions, bending stresses,
millings, pressure, or any other form of mechanical stress
on them.
Los productos eLED SQUARE son sensibles a esfuerzos
mecánicos, evite aplicar tensiones mecánicas, esfuerzos de
ƀGZKÎPHTGUCFQURTGUKÎPQEWCNSWKGTQVTCHQTOCFGGUVTÃU
mecánico.
eLED SQUARE modules should be taken by the edges
of the printed circuit board, never by the top side where the
LED components are.
Tome los módulos eLED SQUARE por los bordes del circuito impreso, nunca sobre la cara top donde se sitúan los
componentes LED.
Handle eLED SQUARE products in protected zones
against static electricity. (ESD Electric Static Discharge).
Manipule los productos eLED SQUARE en zonas protegidas contra la electricidad estática. (ESD Electric Static
Discharge).
A gap between consecutive modules is recommended to
facilitate the thermal expansion.
Se recomienda dejar una separación entre módulos consecutivos para favorecer las dilataciones.
0,5 mm
50
www.elt.es
%QODKPCVKQPUDGVYGGP.%FTKXGTUCPFG.'&.+0'OQFWNGU
Combinaciones de fuentes de alimentación -LC con módulos
eLED LINE
The following tables show the possible combinations of
4000K eLED LINE modules with the most appropriate constant current ELT control gears.
Las siguientes tablas muestran las posibles combinaciones de módulos eLED LINE de 4000K con los drivers apropiados ELT en funcionamiento de corriente constante.
$[OGCPUQHVJGUGVCDNGU[QWYKNNDGCDNGVQſPFVJGOQUV
suitable solution for the most common luminaires that use
6*'6*1QT6ƀWQTGUEGPVCRRNKECVKQPU
En ellas se puede encontrar la solución más adecuada
RCTCNCUNWOKPCTKCUO¶UWUWCNGUFGCRNKECEKQPGUƀWQTGUEGPtes de T5-HE o T5-HO y T8.
016'5
NOTAS:
;QW UVCTV YKVJ VJG NGPIVJ QH VJG ƀWQTGUEGPV NCORU VQ DG
ſVVGF
'NRWPVQFGRCTVKFCGUNCNQPIKVWFFGNCUN¶ORCTCUƀWQTGUcentes a instalar.
6JG ƀWQTGUEGPV NWOKPCKTG FCVC JCXG DGGP ECNEWNCVGF QP
the basis of using an ELT electronic ballast.
.QUFCVQUFGNCUNWOKPCTKCUƀWQTGUEGPVGUJCPUKFQECNEWlados considerando que se ha utilizado un balasto electrónico ELT.
(QNNQYVJGUGUVGRUQTIWKFGNKPGUVQſPFVJGDGUVUQNWVKQP
for your application:
Para encontrar la solución más óptima para su aplicación,
hay que seguir los siguientes pasos o pautas:
Sometimes more than one option will be suggested. The
most suitable one will depend on whether or not you want to
OCKPVCKPVJGUCOGRQYGTCUWUGFD[VJGEWTTGPVƀWQTGUEGPV
lamps, thus increasing the light level or, on the contrary, you
choose to decrease the power and therefore maintain the
TGUWNVKPINWOKPQWUƀWZ
En ocasiones aparecerán más de una opción. La elección
más adecuada dependerá de si se desea mantener la misOCRQVGPEKCSWGRCTCNCUCEVWCNGUN¶ORCTCUƀWQTGUEGPVGU
con lo cual aumentará la luminosidad o por el contrario se
decide por disminuir la potencia y por lo tanto mantener el
ƀWLQNWOKPQUQTGUWNVCPVG
In both cases, the eLED LINE solution will always be more
GHſEKGPVVJCPVJGENCUUKEƀWQTGUEGPVQPG
En ambos casos la solución con eLED LINE siempre será
O¶UGſEKGPVGSWGEQPNCEN¶UKECUQNWEKÎPEQPƀWQTGUEGPEKC
Modules must always be serially connected.
Los módulos se deben conectar siempre en serie.
When choosing the driver from the table, “x2” means that
two independent circuits are needed with a driver for each
one of them, instead of a single one with all the eLED LINEs
in series.
En la elección del driver de la tabla, “x2” representa la necesidad de dos circuitos independientes con un driver para
cada uno de ellos en lugar de uno único con todos los eLED
LINE en serie.
There are rows in blank at the bottom of the table that you
ECPWUGHQTEWUVQOKUGFEQPſIWTCVKQPUFGRGPFKPIQPVJGNWmen or power you want for your application.
'PNCRCTVGDCLCFGNEWCFTQGPEQPVTCT¶WPCUſNCUGPDNCPEQ
GPGNSWGRQFT¶TGCNK\CTUWUEQPſIWTCEKQPGURGTUQPCNK\CFCU
según los lúmenes o potencia que desea para su aplicación.
* We recommend that you visit our web page to get the
same data with 3000K and 5700K modules:
* Le invitamos a visitar nuestra página web para obtener
los mismos datos con módulos de 3000K y 5700K:
YYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
www.elt.es/productos/buscador_producto.html
+H [QW HCKN VQ ſPF VJG CRRNKECVKQP [QW YCPV QT KH [QWT CRplication is for a special luminaire, please contact our commercial department.
*Si no encuentra la aplicación que desea o si su aplicación
es para una luminaria especial, por favor póngase en contacto con el departamento comercial.
Driver + eLED LINE 1 - 3.000K
Driver + eLED LINE 1 - 4.000K.
Driver + eLED LINE 1 - 5.700K.
Driver + eLED LINE 2 - 3.000K.
Driver + eLED LINE 2 - 4.000K.
http://www.elt.es/productos/combinaciones/com_eLED_1_3000K.pdf
http://www.elt.es/productos/combinaciones/com_eLED_1_4000K.pdf
http://www.elt.es/productos/combinaciones/com_eLED_1_5700K.pdf
http://www.elt.es/productos/combinaciones/com_eLED_2_3000K.pdf
http://www.elt.es/productos/combinaciones/com_eLED_2_4000K.pdf
Driver + eLED LINE 2 - 5.700K.
http://www.elt.es/productos/combinaciones/com_eLED_2_5700K.pdf
http://www.elt.es/productos/combinaciones/com_eLED_OCTO_1.pdf
Driver + eLED OCTO 1 - 3.000K - 4.000K - 5.700K.
http://www.elt.es/productos/combinaciones/com_eLED_Square_2_3000K.pdf
Driver + eLED SQUARE 2 - 3.000K.
http://www.elt.es/productos/combinaciones/com_eLED_Square_2_4000K.pdf
Driver + eLED SQUARE 2 - 4.000K.
http://www.elt.es/productos/combinaciones/com_eLED_Square_2_5700K.pdf
Driver + eLED SQUARE 2 - 5.700K.
www.elt.es
51
52
www.elt.es
58W
36W
30W
18W
Lámpara
Lamp
1.500
1 x 58
2 x 1.500
4 x 1.200
4 x 36
2 x 58
2 x 1.200
1.200
1 x 36
2 x 36
890
4 x 590
4 x 18
1 x 30
2 x 590
590
mm
Longitud
Length
2 x 18
1 x 18
Tipo de
Luminaria
Type of
ſVVKPI
10.400
5.200
13.000
6.500
3.250
2.400
5.400
2.700
1.350
Lm
104
104
105
105
102
100
84
84
84
Lm /W
'ſEKGPEKC
luminosa
típica
6[RKECN
NWOKPQWU
GHſECE[
%QPſIWTG[QWTQYPEQODKPCVKQP
%QPſIWTGUWRTQRKCEQODKPCEKÎP
100
50
128
64
32
24
64
32
16
W
Potencia
real con
balasto
electrónico
Flujo
luminoso
típico a temp.
amb. 25 °C
Power
6[RKECN
output
NWOKPQWU
9KVJ
ƀWZCVCOD
GNGEVTQPKE
temp. 25 °C
DCNNCUV
9950501
9950509
eLED LINE 1 800 840
eLED LINE 1 1100 840
eLED LINE 1 1100 840
eLED LINE 1 800 840
9950509
9950501
9950509
9950501
eLED LINE 1 800 840
eLED LINE 1 1100 840
9950509
9950501
eLED LINE 1 800 840
eLED LINE 1 1100 840
9950509
9950501
eLED LINE 1 800 840
eLED LINE 1 1100 840
9950509
9950501
eLED LINE 1 800 840
eLED LINE 1 1100 840
9950509
eLED LINE 1 1100 840
9950501
9950509
eLED LINE 1 1100 840
eLED LINE 1 800 840
9950501
9950509
9950501
eLED LINE 1 800 840
eLED LINE 1 1100 840
eLED LINE 1 800 840
280 mm
80 CRI
4000 K
Modelo
Model
R
19,2
700
500
700
700
500
700
700
500
700
10
5
16
85
61
64
42,5
30,5
32
136
97,6
102,4
68
48,8
8
500
700
51,2
700
34
24,4
700
500
25,5
18,3
25,6
4
3
48,8
700
700
500
700
500
36,8
51,2
500
700
8
24,4
25,6
500
700
18,4
500
12,2
17
4
2
700
500
12,8
700
W
Potencia
típica en
módulo
9,2
ud
en
serie
KP
UGTKGU
6[RKECN
RQYGTKP
module
500
mA
Corriente
máxima
/CZKOWO
current
Nº
eLED
10.700
8.000
8.000
5.350
4.000
4.000
17.120
12.800
12.800
8.560
6.400
6.400
4.280
3.200
3.200
3.210
2.400
2.400
6.400
6.400
4.800
3.200
3.200
2.400
2.140
1.600
1.600
1.200
Lm
Flujo
luminoso
típico a temp.
amb. 25 °C
6[RKECN
NWOKPQWU
ƀWZCVCOD
temp. 25 °C
125
130
125
125
130
125
125
130
125
125
130
125
125
130
125
125
130
125
130
125
130
130
125
130
125
130
125
130
Lm / W
'ſEKGPEKC
luminosa
típica
6[RKECN
NWOKPQWU
GHſECE[
LC 190/700-D - 9918117
LC 150/700-D - 9918107
LC 125/500-A - 9918016
LC 116/700-A - 9918012
LC 116/500-A - 9918011
LC 110/700-B - 9918023
LC 110/500-B - 9918022
Ŗ
x2
Ŗ
Ŗ
x2
Ŗ
x2
Ŗ
Ŗ
x2
x2
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
x2
Ŗ
x2
Ŗ
Ŗ
x2
Ŗ
Ŗ
x2
x2
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
x2
Ŗ
x2
Ŗ
Ŗ
Ŗ
Ŗ
x2
x2
Ŗ
Ŗ
x2
Ŗ
Ŗ
Ŗ
x2
x2
Ŗ
x2
Ŗ
x2
Ŗ
Ŗ
x2
Ŗ
x2
Ŗ
Ŗ
Ŗ
x2
Ŗ
Ŗ
x2
x2
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
x2
Ŗ
LC 150/500-E - 9918172
Ŗ
Ŗ
x2 = Two separate circuits / Dos circuitos independientes
LC 125/700-A - 9918019
&TKXGTUGNGEVKQP
Elección del driver
LC 142/700-C - 9918044
.'&OQFWNGUGNGEVKQPCVElección de la fuente de luz de 4000K
LC 160/700-C - 9918040
(KVVKPIU
Luminaria
LC 150/500-D - 9918105
T8
LC 150/700-E - 9918173
549
1 x 14W
53
1 x 35W
35w
1.449
850
4 x 549
4 x 14W
1 x 21W
2 x 549
2 x 14W
21W
14W
289
1 x 8W
mm
8W
Longitud
Length
Tipo de
Luminaria
Type of
ſVVKPI
Lámpara
Lamp
3.300
1.900
5.000
2.400
1.200
470
Lm
95
92
91
91
91
63
Lm /W
'ſEKGPEKC
luminosa
típica
6[RKECN
NWOKPQWU
GHſECE[
%QPſIWTG[QWTQYPEQODKPCVKQP
%QPſIWTGUWRTQRKCEQODKPCEKÎP
34,7
20,7
54,8
27,4
13,7
7,5
W
Potencia
real con
balasto
electrónico
Flujo
luminoso
típico a temp.
amb. 25 °C
Power
6[RKECN
output
NWOKPQWU
9KVJ
ƀWZCVCOD
GNGEVTQPKE
temp. 25 °C
DCNNCUV
9950509
9950501
9950509
9950501
9950509
9950501
9950509
9950501
eLED LINE 1 1100 840
eLED LINE 1 800 840
eLED LINE 1 1100 840
eLED LINE 1 800 840
eLED LINE 1 1100 840
eLED LINE 1 800 840
eLED LINE 1 1100 840
eLED LINE 1 800 840
9950509
9950501
eLED LINE 1 800 840
eLED LINE 1 1100 840
9950509
9950501
eLED LINE 1 1100 840
eLED LINE 1 800 840
280 mm
80 CRI
4000 K
Modelo
Model
R
30,5
42,5
700
32
700
5
23
500
18,3
500
500
19,2
13,8
3
500
700
48,8
51,2
500
8
36,8
700
500
25,6
24,4
4
500
700
12,2
18,4
500
500
12,8
9,2
700
500
6,1
8,5
2
1
700
500
6,4
700
W
Potencia
típica en
módulo
4,6
ud
en
serie
KP
UGTKGU
6[RKECN
RQYGTKP
module
500
mA
Corriente
máxima
/CZKOWO
current
Nº
eLED
5.350
4.000
4.000
3.000
2.400
2.400
1.800
6.400
6.400
4.800
3.200
3.200
2.400
1.600
1.600
1.200
1.070
800
800
600
Lm
Flujo
luminoso
típico a temp.
amb. 25 °C
6[RKECN
NWOKPQWU
ƀWZCVCOD
temp. 25 °C
125
130
125
130
130
125
130
130
125
130
130
125
130
130
125
130
125
130
125
130
Lm / W
'ſEKGPEKC
luminosa
típica
6[RKECN
NWOKPQWU
GHſECE[
LC 190/700-D - 9918117
LC 150/700-D - 9918107
LC 116/700-A - 9918012
LC 116/500-A - 9918011
LC 110/700-B - 9918023
LC 110/500-B - 9918022
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
X2
X2
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
X2
Ŗ
LC 150/500-E - 9918172
Ŗ
Ŗ
x2 = Two separate circuits / Dos circuitos independientes
LC 125/500-A - 9918016
&TKXGTUGNGEVKQP
Elección del driver
LC 125/700-A - 9918019
.'&OQFWNGUGNGEVKQPCVElección de la fuente de luz de 4000K
LC 142/700-C - 9918044
(KVVKPIU
Luminaria
LC 160/700-C - 9918040
T5 / T5 HE
LC 150/500-D - 9918105
www.elt.es
Ŗ
Ŗ
X2
Ŗ
LC 150/700-E - 9918173
54
www.elt.es
1 x 39W
1 x 49W
1 x 54W
1 x 80W
49W
54W
80W
4 x 24W
2 x 24W
1 x 24W
Tipo de
Luminaria
Type of
ſVVKPI
39W
24W
Lámpara
Lamp
1.449
1.149
1.449
850
4 x 549
2 x 549
549
mm
Longitud
Length
77
83
4.445
6.150
87
82
78
78
78
Lm /W
4.300
3.100
7.000
3.500
1.750
Lm
'ſEKGPEKC
luminosa
típica
6[RKECN
NWOKPQWU
GHſECE[
%QPſIWTG[QWTQYPEQODKPCVKQP
%QPſIWTGUWRTQRKCEQODKPCEKÎP
80
53,8
49,3
38
90
45
22,5
W
Potencia
real con
balasto
electrónico
Flujo
luminoso
típico a temp.
amb. 25 °C
Power
6[RKECN
output
NWOKPQWU
9KVJ
ƀWZCVCOD
GNGEVTQPKE
temp. 25 °C
DCNNCUV
eLED LINE 1 800 840
9950501
9950509
9950501
eLED LINE 1 800 840
eLED LINE 1 800 840
9950509
9950501
eLED LINE 1 800 840
eLED LINE 1 1100 840
9950509
9950501
eLED LINE 1 800 840
eLED LINE 1 1100 840
9950509
9950501
eLED LINE 1 1100 840
eLED LINE 1 800 840
9950509
9950501
eLED LINE 1 800 840
eLED LINE 1 1100 840
9950509
9950501
eLED LINE 1 1100 840
eLED LINE 1 800 840
280 mm
80 CRI
4000 K
Modelo
Model
R
700
700
500
700
700
5
4
42,5
34
24,4
25,6
42,5
30,5
500
25,5
18,3
19,2
68
48,8
51,2
34
24,4
25,6
17
12,2
12,8
W
Potencia
típica en
módulo
32
5
3
8
4
2
ud
en
serie
KP
UGTKGU
6[RKECN
RQYGTKP
module
700
700
500
700
700
500
700
700
500
700
700
500
700
mA
Corriente
máxima
/CZKOWO
current
Nº
eLED
5.350
4.280
3.200
3.200
5.350
4.000
4.000
3.210
2.400
2.400
8.560
6.400
6.400
4.280
3.200
125
125
130
125
125
130
125
125
130
125
125
130
125
125
130
125
125
2.140
3.200
130
125
Lm / W
'ſEKGPEKC
luminosa
típica
6[RKECN
NWOKPQWU
GHſECE[
1.600
1.600
Lm
Flujo
luminoso
típico a temp.
amb. 25 °C
6[RKECN
NWOKPQWU
ƀWZCVCOD
temp. 25 °C
LC 190/700-D - 9918117
LC 150/700-D - 9918107
LC 125/500-A - 9918016
LC 116/700-A - 9918012
LC 116/500-A - 9918011
LC 110/700-B - 9918023
LC 110/500-B - 9918022
Ŗ
Ŗ
Ŗ
Ŗ
x2
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
x2
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
x2
Ŗ
Ŗ
Ŗ
Ŗ
x2
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
x2 = Two separate circuits / Dos circuitos independientes
LC 125/700-A - 9918019
&TKXGTUGNGEVKQP
Elección del driver
LC 142/700-C - 9918044
.'&OQFWNGUGNGEVKQPCVElección de la fuente de luz de 4000K
LC 160/700-C - 9918040
(KVVKPIU
Luminaria
LC 150/500-D - 9918105
T5 / T5 HO
LC 150/500-E - 9918172
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
x2
Ŗ
Ŗ
LC 150/700-E - 9918173
www.elt.es
55
58W
36W
30W
18W
Lámpara
Lamp
1.200
2 x 1.200
4 x 1.200
1.500
1 x 36
2 x 36
4 x 36
1 x 58
2 x 1.500
890
1 x 30
4 x 590
4 x 18
590
mm
Longitud
2 x 590
2 x 58
(KVVKPIU
Luminaria
100
50
128
64
32
24
64
32
16
W
10.400
5.200
13.000
6.500
3.250
2.400
5.400
2.700
1.350
lm
Potencia
Flujo
real con
luminoso
balasto
típico a temp.
electrónico amb. 25 °C
Power
6[RKECN
QWVRWVYKVJ NWOKPQWU
GNGEVTQPKE ƀWZCVCOD
Length
DCNNCUV
temp. 25 °C
2 x 18
1 x 18
Tipo de
Luminaria
Type of
ſVVKPI
T8
104
104
105
105
102
100
84
84
84
lm /W
'ſEKGPEKC
luminosa
típica
6[RKECN
NWOKPQWU
GHſECE[
500
eLED LINE 1 1100 840 - 9950509
+
eLED LINE 2 2100 840 - 9950527
eLED LINE 1 1100 840 - 9950509
+
eLED LINE 2 2100 840 - 9950527
eLED LINE 2 2100 840 - 9950527
eLED LINE 2 1350 840 - 9950522
eLED LINE 2 2100 840 - 9950527
eLED LINE 2 1350 840 - 9950522
700
700
700
4
2
2
1
85,4
42,7
136,6
97,6
500
68,3
48,8
42,7
34,2
25,6
85,4
8
4
2
1
1
700
700
500
700
700
24,4
700
eLED LINE 2 1350 840 - 9950522
eLED LINE 2 2100 840 - 9950527
21,4
700
1
1
18,3
eLED LINE 1 1100 840 - 9950509
+
eLED LINE 2 2100 840 - 9950527
17,1
500
1
eLED LINE 1 1100 840 - 9950509
+
eLED LINE 2 2100 840 - 9950527
1
68,3
700
700
48,8
500
4
42,7
700
34,2
24,4
2
500
700
21,4
17,1
700
700
12,2
1
500
W
Potencia
típica en
módulo
10,7
ud
en
serie
KP
UGTKGU
6[RKECN
RQYGTKP
module
700
mA
Corriente
máxima
/CZKOWO
current
Nº
eLED
eLED LINE 1 800 840 - 9950501
+
eLED LINE 2 1350 840 - 9950522
eLED LINE 2 2100 840 - 9950527
eLED LINE 2 1350 840 - 9950522
eLED LINE 2 2100 840 - 9950527
eLED LINE 2 1350 840 - 9950522
eLED LINE 2 2100 840 - 9950527
eLED LINE 2 1350 840 - 9950522
560 mm
80 CRI
4000 K
Modelo
Model
R
.'&OQFWNGUGNGEVKQPCVElección de la fuente de luz de 4000K
10.540
5.270
16.800
13.120
10.800
8.400
6.560
5.400
4.200
3.280
2.700
3.170
2.440
2.150
8.400
6.560
5.400
4.200
3.280
2.700
2.100
1.640
1.350
lm
Flujo
luminoso
típico a temp.
amb. 25 °C
6[RKECN
NWOKPQWU
ƀWZCVCOD
temp. 25 °C
123
123
123
134
126
123
134
126
123
134
126
124
133
126
123
134
126
123
134
126
123
134
126
lm / W
'ſEKGPEKC
luminosa
típica
6[RKECN
NWOKPQWU
GHſECE[
LC 150/500-E - 9918172
LC 190/700-D - 9918117
LC 150/500-D - 9918105
LC 160/700-C - 9918040
LC 142/700-C - 9918044
LC 125/700-A - 9918019
LC 125/500-A - 9918016
LC 116/700-A - 9918012
LC 116/500-A - 9918011
x2
x2
Ŗ
x2
x2
Ŗ
x2
Ŗ
Ŗ
x2
Ŗ
Ŗ
x2
x2
Ŗ
Ŗ
x2
x2
Ŗ
Ŗ
x2
Ŗ
Ŗ
x2
Ŗ
x2
Ŗ
x2
x2
Ŗ
x2
Ŗ
x2
x2
Ŗ
Ŗ
x2
Ŗ
Ŗ
Ŗ
x2
Ŗ
Ŗ
x2
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
x2
x2
Ŗ
x2
x2
x2
Ŗ
Ŗ
Ŗ
x2
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
x2 = Two separate circuits / Dos circuitos independientes
LC 150/700-D - 9918107
&TKXGTUGNGEVKQP
Elección del driver
LC 150/700-E - 9918173
56
www.elt.es
1 x 35W
35W
1.449
850
4 x 549
4 x 14W
1 x 21W
2 x 549
549
mm
Longitud
2 x 14W
1 x 14W
Tipo de
Luminaria
21W
14W
Lámpara
Lamp
Type of
ſVVKPI
34,7
20,7
54,8
27,4
13,7
W
3.300
1.900
4.800
2.400
1.200
lm
Potencia
Flujo
real con
luminoso
balasto
típico a temp.
electrónico amb. 25 °C
Power
6[RKECN
QWVRWVYKVJ NWOKPQWU
GNGEVTQPKE ƀWZCVCOD
Length
DCNNCUV
temp. 25 °C
95
92
91
91
91
lm /W
'ſEKGPEKC
luminosa
típica
6[RKECN
NWOKPQWU
GHſECE[
500
700
500
eLED LINE 1 1100 840 - 9950509
+
eLED LINE 2 2100 840 - 9950527
eLED LINE 1 1100 840 - 9950509
+
eLED LINE 2 2100 840 - 9950527
eLED LINE 1 800 840 - 9950501
+
eLED LINE 2 1350 840 - 9950522
700
700
eLED LINE 1 800 840 - 9950501
+
eLED LINE 2 1350 840 - 9950522
eLED LINE 1 800 840 - 9950501
+
eLED LINE 2 1350 840 - 9950522
500
700
2
1
2
1
1
1
1
1
1
1
4
27,8
19,8
25,6
18,3
17,1
48,8
42,7
30,5
500
21,4
24,4
2
500
700
12,2
15,3
500
500
10,7
1
700
W
Potencia
típica en
módulo
6[RKECN
RQYGTKP
module
7,6
ud
en
serie
KP
UGTKGU
Nº
eLED
500
mA
Corriente
máxima
/CZKOWO
current
eLED LINE 2 2100 840 - 9950527
eLED LINE 2 1350 840 - 9950522
eLED LINE 2 2100 840 - 9950527
eLED LINE 2 1350 840 - 9950522
eLED LINE 2 2100 840 - 9950527
eLED LINE 2 1350 840 - 9950522
560 mm
80 CRI
4000 K
Modelo
Model
R
3.500
2.650
3.170
2.440
2.150
6.560
5.400
4.100
3.280
2.700
2.050
1.640
1.350
1.025
lm
Flujo
luminoso
típico a temp.
amb. 25 °C
6[RKECN
NWOKPQWU
ƀWZCVCOD
temp. 25 °C
126
134
124
133
126
134
126
134
134
126
134
134
126
134
lm / W
'ſEKGPEKC
luminosa
típica
6[RKECN
NWOKPQWU
GHſECE[
LC 190/700-D - 9918117
LC 150/700-D - 9918107
LC 125/500-A - 9918016
LC 116/700-A - 9918012
LC 116/500-A - 9918011
LC 110/700-B - 9918023
LC 110/500-B - 9918022
Ŗ
x2
x2
Ŗ
Ŗ
x2
x2
Ŗ
Ŗ
x2
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
x2
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
LC 150/500-E - 9918172
Ŗ
Ŗ
x2 = Two separate circuits / Dos circuitos independientes
LC 125/700-A - 9918019
&TKXGTUGNGEVKQP
Elección del driver
LC 142/700-C - 9918044
.'&OQFWNGUGNGEVKQPCVElección de la fuente de luz de 4000K
LC 160/700-C - 9918040
(KVVKPIU
Luminaria
LC 150/500-D - 9918105
T5 / T5 HE
Ŗ
Ŗ
Ŗ
LC 150/700-E - 9918173
57
1 x 49W
1 x 54W
1 x 80W
49W
54W
80W
1.449
1.149
1.449
850
4 x 549
4 x 24W
1 x 39W
2 x 549
549
mm
Longitud
2 x 24
1 x 24W
Tipo de
Luminaria
Type of
ſVVKPI
39W
24W
Lámpara
Lamp
80
53,8
49,3
38
90
45
22,5
W
6.150
4.450
4.300
3.100
7.000
3.500
1.750
lm
Potencia
Flujo
real con
luminoso
balasto
típico a temp.
electrónico amb. 25 °C
Power
6[RKECN
QWVRWVYKVJ NWOKPQWU
GNGEVTQPKE ƀWZCVCOD
Length
DCNNCUV
temp. 25 °C
77
83
87
82
78
78
78
lm /W
'ſEKGPEKC
luminosa
típica
6[RKECN
NWOKPQWU
GHſECE[
700
700
eLED LINE 2 2100 840 - 9950527
eLED LINE 1 1100 840 - 9950509
+
eLED LINE 2 2100 840 - 9950527
700
500
eLED LINE 1 1100 840 - 9950509
+
eLED LINE 2 2100 840 - 9950527
eLED LINE 1 1100 840 - 9950509
+
eLED LINE 2 2100 840 - 9950527
700
700
500
700
500
700
500
mA
Corriente
máxima
/CZKOWO
current
eLED LINE 1 1100 840 - 9950509
+
eLED LINE 2 2100 840 - 9950527
eLED LINE 2 2100 840 - 9950527
eLED LINE 2 2100 840 - 9950527
eLED LINE 2 2100 840 - 9950527
560 mm
80 CRI
4000 K
Modelo
Model
R
2
1
2
2
1
2
1
1
1
4
2
1
ud
en
serie
KP
UGTKGU
Nº
eLED
42,7
34,2
42,7
30,5
25,6
68,3
48,8
34,2
24,4
17,1
12,2
W
Potencia
típica en
módulo
6[RKECN
RQYGTKP
module
5.270
4.200
5.270
4.080
3.170
8.400
6.560
4.200
3.280
2.100
1.640
lm
Flujo
luminoso
típico a temp.
amb. 25 °C
6[RKECN
NWOKPQWU
ƀWZCVCOD
temp. 25 °C
123
123
123
134
124
123
134
123
134
123
134
lm / W
'ſEKGPEKC
luminosa
típica
6[RKECN
NWOKPQWU
GHſECE[
LC 190/700-D - 9918117
LC 150/700-D - 9918107
LC 116/700-A - 9918012
LC 116/500-A - 9918011
LC 110/700-B - 9918023
LC 110/500-B - 9918022
x2
x2
Ŗ
x2
x2
Ŗ
Ŗ
x2
x2
x2
x2
Ŗ
Ŗ
Ŗ
x2
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
x2
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
x2
Ŗ
Ŗ
x2 = Two separate circuits / Dos circuitos independientes
LC 125/500-A - 9918016
&TKXGTUGNGEVKQP
Elección del driver
LC 125/700-A - 9918019
.'&OQFWNGUGNGEVKQPCVElección de la fuente de luz de 4000K
LC 142/700-C - 9918044
(KVVKPIU
Luminaria
LC 160/700-C - 9918040
T5 / T5 HO
LC 150/500-D - 9918105
www.elt.es
LC 150/500-E - 9918172
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
x2
Ŗ
LC 150/700-E - 9918173
58
www.elt.es
1 x 32W
32W
33
2 x 18W
32
24
16,5
1 x 18W
1 x 26W
25
2.400
1.800
2.400
1.200
1.800
900
lm
W
12,5
Flujo
luminoso
típico a temp. amb.
25 °C
6[RKECN
NWOKPQWUƀWZCV
CODVGOR°C
Potencia real
con balasto
electrónico
2 x 13W
1 x 13W
Tipo de
Luminaria
26W
18W
13W
Lámpara
Lamp
Type of
ſVVKPI
Power output
9KVJGNGEVTQPKE
DCNNCUV
75
75
73
73
72
72
lm /W
'ſEKGPEKC
luminosa
típica
6[RKECN
NWOKPQWU
GHſECE[
mA
ud
/CZKOWO Nº eLED
current
KPUGTKGU
Corriente
máxima
en serie
W
Potencia
típica en
módulo
6[RKECN
RQYGTKP
module
lm
Flujo
luminoso
típico a temp.
amb. 25 °C
6[RKECN
NWOKPQWUƀWZ
CVCODVGOR
25 °C
9950557
eLED OCTO 1 2250 840
9950557
9950552
eLED OCTO 1 1850 840
eLED OCTO 1 2250 840
9950557
eLED OCTO 1 2250 840
9950552
9950557
eLED OCTO 1 2250 840
eLED OCTO 1 1850 840
9950552
9950552
eLED OCTO 1 1850 840
eLED OCTO 1 1850 840
700
500
700
700
500
500
700
500
1
1
1
1
19,5
13,5
14,9
19,5
10,7
13,5
14,9
10,7
2.250
1.725
1.850
2.250
1.435
1.725
1.850
1.435
.'&OQFWNGUGNGEVKQPCV-Elección de la fuente de luz de 4000K
I 165 mm
80 CRI
Modelo
Model
R
115
128
123
115
134
128
123
134
lm / W
'ſEKGPEKC
luminosa típica
6[RKECN
NWOKPQWU
GHſECE[
LC 116/500-A - 9918011
LC 116/700-A - 9918012
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
LC 125/500-A - 9918016
Ŗ
Ŗ
/
LC 125/700-A - 9918019
Ŗ
Ŗ
LC 125/500-A-UN - 9918262
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
LC 125/700-A-UN - 9918263
&TKXGTUGNGEVKQP Elección del driver
Ŗ
Ŗ
Ŗ
Ŗ
LC 125/700-A-UN - 9918263
.'&OQFWNGUGNGEVKQPElección de la fuente de luz
Ŗ
Ŗ
DLC 116/700-A - 9918236
TC-D / TC-DE / TC-T / TC-TE (KVVKPIU.WOKPCTKC
Ŗ
Ŗ
DLC 125/700-A - 9918256
18W
Lámpara
Lamp
59
590
2 x 590
4 x 590
1 x 18W
2 x 18W
4 x 18W
mm
Longitud
5.400
2.700
1.350
lm
84
84
84
lm /W
'ſEKGPEKC
luminosa
típica
6[RKECN
NWOKPQWU
GHſECE[
%QPſIWTG[QWTQYPEQODKPCVKQP
%QPſIWTGUWRTQRKCEQODKPCEKÎP
64
32
16
W
Flujo
Potencia
luminoso
real con
típico a temp.
balasto
amb. 25 °C
electrónico
Type of
ſVVKPI
Tipo de
Luminaria
Power
6[RKECN
output
NWOKPQWU
9KVJ
ƀWZCVCOD
GNGEVTQPKE
temp. 25 °C
DCNNCUV
Length
(KVVKPIU
Luminaria
T8
eLED SQUARE 2 1700 840 9950542
eLED SQUARE 2 1700 840 9950542
eLED SQUARE 2 1700 840 9950542
250 x 250 mm
80 CRI
4000 K
Modelo
Model
R
700
500
700
500
700
500
mA
Corriente
máxima
/CZKOWO
current
4
2
1
ud
en
serie
KP
UGTKGU
Nº
eLED
51,2
36,6
25,6
18,3
12,8
9,2
W
Potencia
típica en
módulo
6[RKECN
RQYGTKP
module
6.800
5.200
3.400
2.600
1.700
1.300
lm
Flujo
luminoso
típico a temp.
amb. 25 °C
6[RKECN
NWOKPQWU
ƀWZCVCOD
temp. 25 °C
133
142
133
142
133
142
lm / W
'ſEKGPEKC
luminosa
típica
6[RKECN
NWOKPQWU
GHſECE[
LC 150/700-E - 9918173
LC 150/500-E - 9918172
LC 190/700-D - 9918117
LC 142/700-C - 9918044
LC 125/500-A - 9918016
LC 116/700-A - 9918012
LC 116/500-A - 9918011
LC 110/500-B - 9918022
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
x2 = Two separate circuits / Dos circuitos independientes
LC 160/700-C - 9918040
&TKXGTUGNGEVKQP
Elección del driver
LC 150/500-D - 9918105
.'&OQFWNGUGNGEVKQPCVElección de la fuente de luz de 4000K
LC 150/700-D - 9918107
www.elt.es
2 x 549
4 x 549
4 x 14W
549
mm
2 x 14W
1 x 14W
Tipo de
Luminaria
Longitud
Length
24W
Lámpara
Lamp
2 x 549
4 x 549
4 x 24
549
mm
Longitud
Length
2 x 24
1 x 24
Tipo de
Luminaria
Type of
ſVVKPI
T5 / T5 HO
14W
Lámpara
Lamp
(KVVKPIU
Luminaria
4.800
2.400
1.200
lm
7.000
3.500
1.750
lm
78
78
78
lm /W
'ſEKGPEKC
luminosa
típica
6[RKECN
NWOKPQWU
GHſECE[
91
91
91
lm /W
'ſEKGPEKC
luminosa
típica
%QPſIWTG[QWTQYPEQODKPCVKQP
%QPſIWTGUWRTQRKCEQODKPCEKÎP
90
45
22,5
W
Potencia
real con
balasto
electrónico
Flujo
luminoso
típico a temp.
amb. 25 °C
Power
6[RKECN
output
NWOKPQWU
9KVJ
ƀWZCVCOD
GNGEVTQPKE
temp. 25 °C
DCNNCUV
54,8
27,4
13,7
W
Potencia
real con
balasto
electrónico
Flujo
luminoso
típico a temp.
amb. 25 °C
Model
eLED SQUARE 2 1700 840 9950542
eLED SQUARE 2 1700 840 9950542
eLED SQUARE 2 1700 840 9950542
250 x 250 mm
80 CRI
4000 K
Modelo
R
700
500
700
500
700
500
mA
Corriente
máxima
4
2
1
ud
en
serie
KP
UGTKGU
51,2
36,6
25,6
18,3
12,8
9,2
W
Potencia
típica en
módulo
700
500
700
500
700
500
mA
Corriente
máxima
/CZKOWO
current
4
2
1
ud
en
serie
KP
UGTKGU
Nº
eLED
51,2
36,6
25,6
18,3
12,8
9,2
W
Potencia
típica en
módulo
6[RKECN
RQYGTKP
module
.'&OQFWNGUGNGEVKQPCVElección de la fuente de luz de 4000K
eLED SQUARE 2 1700 840 9950542
eLED SQUARE 2 1700 840 9950542
eLED SQUARE 2 1700 840 9950542
250 x 250 mm
80 CRI
4000 K
Modelo
Model
/CZKOWO
current
6.800
5.200
3.400
2.600
1.700
1.300
lm
Flujo
luminoso
típico a temp.
amb. 25 °C
6[RKECN
NWOKPQWU
ƀWZCVCOD
temp. 25 °C
6.800
5.200
3.400
2.600
1.700
1.300
lm
Flujo
luminoso
típico a temp.
amb. 25 °C
133
142
133
142
133
142
lm / W
'ſEKGPEKC
luminosa
típica
6[RKECN
NWOKPQWU
GHſECE[
133
142
133
142
133
142
lm / W
'ſEKGPEKC
luminosa
típica
6[RKECN
NWOKPQWU
GHſECE[
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
&TKXGTUGNGEVKQP
Elección del driver
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
x2 = Two separate circuits / Dos circuitos independientes
LC 110/500-B - 9918022
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
x2 = Two separate circuits / Dos circuitos independientes
LC 110/500-B - 9918022
Type of
ſVVKPI
LC 116/500-A - 9918011
LC 116/500-A - 9918011
6[RKECN
NWOKPQWU
ƀWZCVCOD
temp. 25 °C
LC 116/700-A - 9918012
LC 116/700-A - 9918012
6[RKECN
RQYGTKP
module
LC 125/500-A - 9918016
LC 125/500-A - 9918016
Nº
eLED
LC 142/700-C - 9918044
LC 142/700-C - 9918044
R
LC 160/700-C - 9918040
LC 160/700-C - 9918040
6[RKECN
NWOKPQWU
GHſECE[
LC 150/500-D - 9918105
Power
6[RKECN
output
NWOKPQWU
9KVJ
ƀWZCVCOD
GNGEVTQPKE
temp. 25 °C
DCNNCUV
LC 150/500-D - 9918105
&TKXGTUGNGEVKQP
Elección del driver
LC 190/700-D - 9918117
LC 190/700-D - 9918117
.'&OQFWNGUGNGEVKQPCVElección de la fuente de luz de 4000K
LC 150/500-E - 9918172
LC 150/500-E - 9918172
(KVVKPIU
Luminaria
LC 150/700-E - 9918173
LC 150/700-E - 9918173
T5 / T5 HE
LC 150/700-D - 9918107
LC 150/700-D - 9918107
60
www.elt.es
Electronic transformers for 12Vac LED lamps
Transformadores electrónicos para lámparas LED de 12Vac
LTC-LED
220-240V
50-60Hz
29
38
3,6
122
131
Output power range
Model
Modelo
LTC 5/23-LED
Max.temp.
at tc point
Input current
Output voltage
Corriente de entrada
Tensión de salida
Temp.máx.
envolvente
Operating temp.
Temp.
funcionamiento
Ref. No.
Rango de
potencia en módulo
W
A
V
tc (°C)
ta (°C)
9918200
5... 50
0,23
12
70
-20... +50
~ For LED lamps 12V type MR16.
~ Class II protection. Indoor use.
~ Small dimensions that allows installation inside:
40 x 30 mm. or ø50 mm.
~ Equipped with terminal cover and cable clamps.
~ Clamping screws on primary and secondary circuits for cables with
diameter: 3 mm. min. to 8 mm. max.
~ Max. section terminal area 2,5 mm2.
~ Suitable for installation on wooden surfaces.
~ Overload protection.
~ Thermal protection.
~ Permitted input voltage AC: 198-264V.
~ Para lámparas LED de 12V tipo MR16.
~ Protección Clase II. Uso interior.
~ Dimensiones compactas, permite el montaje en espacios:
40 x 30 mm. o ø50 mm.
~ Equipados con cubre-clemas y prensa-cables
~ Cierra cables primario y secundario para conductores
entre 3 y 8 mm. de diámetro.
~ Sección máxima en clemas 2,5 mm2.
~ Aptos para el montaje sobre madera.
~ Protección contra sobrecarga.
~ Protección contra sobretemperatura.
~ Tensión permitida AC: 198-264V.
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
2TQFWEVUGNGEVKQPRCICPFYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
Instructions manual on www.elt.es/productos/inst_manual.html
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
Selección de producto pág. 51 y www.elt.es/productos/buscador_producto.html
Manual de instrucciones en www.elt.es/productos/manual_instrucciones.html
Minimum installation distance
Distancia mínima de instalación
110
M
M
EN 61347-2-2 Safety / Seguridad
EN 61000-3-2 Harmonics / Armónicos
EN 55015 Interferences / Interferencias
EN 61547 EMC Immunity / Inmunidad CEM
www.elt.es
61
D
C
C
D
D
IP20 Constant voltage control gear for LED modules
Equipos de alimentación IP20 de tensión constante para
módulos LED
C
FAV-B IP20
220-240V
50-60Hz
B
A
B
A
B
A
15W
Model
Modelo
50-75W
20-30W
Ref. No.
Output
power
range
Output
voltage
range
Rango de
potencia en
módulo
Output
current
Power
factor
Max.temp. at
tc point
Operating
temp.
Rango de
tensión de
salida
Corriente de
salida
Factor de
potencia
Temp.máx.
envolvente
Temp.
funcionamiento
W
Vdc
A
NJ
tc (°C)
ta (°C)
A
mm
B
mm
C
mm
D
mm
Dimensions
Dimensiones
15W
FAV 15/12-B
9907103
15
12
1,25
Ů
80
-20... +45
111,5
79,7
44
19,1
FAV 15/24-B
9907123
15
24
0,625
Ů
80
-20... +45
111,5
79,7
44
19,1
22,5
20-30W
FAV 20/12-B
9907104
20
12
1,67
Ů
80
-20... +45
148
137
45,8
FAV 30/12-B
9907105
30
12
2,5
Ů
80
-20... +45
167,9
159,8
51
24
FAV 20/24-B
9907124
20
24
0,83
Ů
80
-20... +45
148
137
45,8
22,5
FAV 30/24-B
9907125
30
24
1,25
Ů
80
-20... +45
167,9
159,8
51
24
FAV 50/12-B
9907107
50
12
4,16
Ů
80
-20... +45
172,2
136,5
63
30
FAV 75/12-B
9907108
75
12
6,25
Ů
80
-20... +45
193,2
157.5
63
30
FAV 50/24-B
9907127
50
24
2,08
Ů
80
-20... +45
172,2
136,5
63
30
FAV 75/24-B
9907128
75
24
3,125
Ů
80
-20... +45
193,2
157.5
63
30
50-75W
~Suitable for constant voltage LED modules.
~ Indoor use.
~ SELV.
~ High perfomance.
~ Low ripple and noise.
~ Short circuit protection.
~ Overload protection.
~ Permitted voltage 198-264V, 50-60Hz.
~ Para módulos LED de tensión constante.
~ Uso interior.
~ SELV.
~ Alto rendimiento.
~ Baja tensión de rizado y ruido.
~ Protección contra cortocircuitos.
~ Protección contra sobre cargas.
~ Tensión permitida 198-264V, 50-60Hz.
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
SELV
110
EN-61347-1 Safety / Seguridad
EN-61347-2-13 Pasticular requiremenst
Requisitos particulares
EN-62384 Perfomance / Funcionamiento
EN-61000-3-2 Harmonics / Armónicos
EN-55015 Interferences / Interferencias
EN-61547 EMC Immunity / Inmunidad CEM
N
L
PRI
62
SEC
Lamp LED
www.elt.es
IP67 Constant voltage control gear for 75, 100 or 200W LED modules
Equipos de alimentación IP67 de tensión constante para módulos
LED de 75, 100 o 200W
F
C
D
E
B
A
Model
Modelo
Ref.
No.
Output
power
range
Output
voltage
range
Rango de
potencia en
módulo
Rango de
tensión de
salida
W
Vdc
Output
current
Power
factor
Max.temp.
at tc point
Operating
temp.
Dimensions
Temp.
Corriente Factor de Temp.máx.
de salida potencia envolvente funcionamiento
A
tc (°C)
NJ
ta (°C)
Dimensiones
A
mm
B
mm
C
mm
D
E
F
mm mm mm
FAV 75/12-B-EN
9907148
75
12
6,25
Ů
80
-20... +45
198
181,9
171
33,8
67,6
35
FAV 100/12-B-EN
9907149
100
12
8,33
Ů
80
-20... +45
218
201,9
191
33,8
67,6
35
FAV 200/12-B-EN
9907151
200
12
16,7
Ů
80
-20... +45
226,4
219,2
211,6
52
78
43
FAV 75/24-B-EN
9907168
75
24
3,125
Ů
80
-20... +45
198
181,9
171
33,8
67,6
35
FAV 100/24-B-EN
9907169
100
24
4,16
Ů
80
-20... +45
218
201,9
191
33,8
67,6
35
FAV 200/24-B-EN
9907171
200
24
8,33
Ů
80
-20... +45
226,4
219,2
211,6
52
78
43
~Suitable for constant voltage LED modules
~ Outdoor use
~ Independent use
~ Class I.
~ Equiv. SELV
~ High perfomance
~ Low ripple and noise
~ Short circuit protection
~ Overload protection
~ Permitted voltage 198-264V, 50-60Hz.
~ Para módulos LED de tensión constante
~ Uso exterior
~ Independiente
~ Clase I.
~ Equiv. SELV
~ Alto rendimiento
~ Baja tensión de rizado y ruido
~ Protección contra cortocircuitos
~ Protección contra sobre cargas
~ Tensión permitida 198-264V, 50-60Hz.
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
SELV RoHS
EN-61347-1 Safety / Seguridad
EN-61347-2-13 Pasticular requiremenst
Requisitos particulares
EN-61000-3-2 Harmonics / Armónicos
EN-55015 Interferences / Interferencias
EN-61547 EMC Immunity / Inmunidad CEM
UL8750
UL1012
www.elt.es
110
R
TU V heinland
CERTIFIED
Type Approved
Safety
Regular
Production
Surveillance
www.tuv.com
ID 200000000 0
Electromagnetic
Compatibility
Regular Production
Surveillance
R
TU V heinland
CERTIFIED
www. tuv. com
ID 4000000000
Red
Yellow-green
L
N
Brown
PRI
Lamp LED
SEC
Blue
Black
63
FAV-B-EN
IP67
220-240V
50-60Hz
.'&VGEJPQNQI[KPFGZ
Índice tecnologia LED
1.- INTRODUCTION
1.- INTRODUCCIÓN
2.- GENERAL COMMENTS
2.1.- What is an LED? How does it work?
2.- GENERALIDADES
2.1.- ¿Qué es un LED? ¿Cómo funciona?
2.2.- Principle behind LED operation
2.2.- Principio de funcionamiento del LED
2.3.- LED lighting advantages
2.3.- Ventajas de la iluminación LED
3.2.- Color Rendering Index - CRI
3.- CONCEPTOS FUNDAMENTALES DEL LED Y
MÓDULOS LED
3.1.- Temperatura de Color Correlacionada - CCT
.WOKPQWUƀWZ.WOGP
NO
3.2.- Índice de Reproducción Cromática - CRI
3.4.- Luminous intensity – Candela (cd)
3.3.- Flujo luminoso - Lumen (lm)
3.5.- Iluminance – Lux (lm/m )
3.4.- Intensidad luminosa – Candela (cd)
.WOKPQWUGHſECE[Ō
NOY
3.5.- Iluminancia – Lux (lm/m2)
3.7.- Luminous distribution curve
'ſEKGPEKCNWOKPQUCŌ
NOY
3.- BASIC LED AND LED MODULES CONCEPTS
3.1.- Correlated Color Temperature - CCT
2
3.7.- Curva de distribución luminosa
4.- LED MODULES
4.1.- Selecting an LED – Binning
4.- MÓDULOS LED
4.1.- Elección de un LED – Binning
4.2.- MacAdam ellipses - SDCM
4.2.- Elipses de MacAdam - SDCM
4.3.- Electrical circuit
4.3.- Circuito eléctrico
4.4.- Heat management
4.4.- Gestión térmica
4.5.- Zhaga Consortium
4.5.- Zhaga Consortium
5.- CONTROL GEARS
5.1.- Constant voltage control
5.- FUENTES DE ALIMENTACIÓN
5.1.- Control por tensión constante
5.2.- Constant current control
5.2.- Control por corriente constante
5.3.- Constant current control gear
5.3.- Fuente de alimentación de corriente constante
5.3.1.- Single-stage converters
5.3.1.- Convertidores de una etapa o Single-Stage
5.3.2.- Multi-stage converters
5.3.2.- Convertidores de varias etapas intermedias
5.3.3.- Basic control gear protections
5.4.- Lighting regulation and control systems
5.3.3.- Protecciones básicas de una fuente de
alimentación
5.4.1.- Regulation methods.
5.4.- Sistemas de regulación y control del alumbrado
5.4.2.- Control system components.
5.4.1.- Métodos de regulación.
5.4.2.- Componentes del sistema de control.
6.- SELECTING LED TECHNOLOGY
6.- ELECCIÓN TECNOLOGIA LED
7.- MARKS AND INDICATIONS
7.- MARCAS E INDICACIONES
www.elt.es
65
LED technology is rapidly developing and is going to
bring about changes to the lighting sector. There are
already LED applications in a host of devices, mobile
RJQPGU 68U VTCHſE NKIJVU KPHQTOCVKQP RCPGNU UKIPCNU
etc. However, it must be borne in mind that each type of
lighting has to meet certain requirements and LED technology must be designed to make the most of all its advantages.
La tecnología LED está evolucionado a gran velocidad y
va suponer un cambio en el sector de la iluminación. Hoy
en día ya existen aplicaciones LED, en multitud de dispositivos, móviles, televisores, semáforos, paneles informativos,
señalizaciones… Hay que tener en cuenta que cada tipo de
iluminación necesita cumplir con requisitos particulares y la
tecnología LED debe ser diseñada para obtener todas sus
ventajas.
1.- INTRODUCTION
1.- INTRODUCCIÓN
LED technology is already used in decorative and public
areas and is going to be implemented in all systems, both
indoors and outdoors.
La tecnología LED ya está presente en la iluminación decorativa y espacios públicos y se va a ir implantando en todas los sistemas tanto de tipo interior como de exterior.
ELT’s 35+ years of experience in the lighting sector provide you with a complete catalogue containing LED technology
that includes the latest developments in LED modules and
control gears. We want your new ideas to become a reality,
to which end we wish to make all our expertise and technical
advice available to you. This document is intended a basical
knowledge to enable you to make the right choice when it
comes to your lighting systems.
ELT con más de 35 años de experiencia en el sector de
la iluminación pone a su alcance un catálogo completo con
tecnología LED que incluyen desarrollos en fuentes de alimentación y módulos LED. Queremos que sus nuevas ideas
puedan convertirse en realidad para lo cual ponemos a su
disposición nuestro know-how y asesoramiento técnico. El
presente documento pretende ser una base de conocimiento
para una buena elección en los sistemas de iluminación.
2.- GENERAL COMMENTS
2.- GENERALIDADES
9JCVKUCP.'&!*QYFQGUKVYQTM!
2.1.- ¿Qué es un LED? ¿Cómo funciona?
The abbreviation LED stands for “light-emitting
diode”. An LED is a semiconductor device made
up of two terminals, an anode (A) and a cathode (K), which emits light in the visible spectrum
when directly polarised (Vanode>Vcathode).
This light increases as the current passing
through increases.
+
-
Cathode
Cátodo
Anode
Ánodo
LED diode symbol
Las siglas de LED corresponden a “Diodo
Emisor de Luz”, y provienen del acrónimo inglés
“Light-emitting-diode”.
Un LED es un dispositivo semiconductor formado por dos terminales, ánodo (A) y cátodo (K),
el cual emite luz en el espectro visible cuando
GUV¶ RQNCTK\CFQ GP FKTGEVC 8¶PQFQ 8E¶VQFQ
Está luminosidad aumenta conforme aumenta la
corriente que lo atraviesa.
6JGDCUKERCTCOGVGTUVQFGſPGCP.'&FKQFG Símbolo de un diodo LED
are: direct voltage (Vd) and maximum direct current (Id_max).
.QURCT¶OGVTQUD¶UKEQURCTCFGſPKTCWPFKQFQ.'&UQP
$CUKECNN[CP.'&FKQFGKUCUQNKFUVCVGNCORYKVJPQſNCment or surrounding inert gas and no encasing glass capsule.
tensión directa (Vd) y corriente directa máxima (Id_max).
Básicamente, un diodo LED es una lámpara en estado sóNKFQUKPſNCOGPVQPKICUKPGTVGCUWCNTGFGFQT[UKPPKPIWPC
capsula de vidrio recubriéndolo.
Moreover, it has no operating cut-off point, but rather it gradually weakens in the course of its service life, reducing its
lighting capacity in accordance with two factors:
Además, no tiene un punto de cese de funcionamiento,
sino que su degradación es gradual a lo largo de su vida,
reduciendo su capacidad lumínica en función de los factores:
~ The quality of the semiconductor.
~ The heat dissipation of the system made up of the LED,
the printed circuit design and the luminaire into which it
KUſVVGF
~ La calidad del semiconductor.
~ Ambient operating temperature.
~ La disipación térmica del sistema compuesto por el LED,
el diseño del circuito impreso y la luminaria donde se
instale.
~ The LED polarising point in voltage and current.
~ La temperatura ambiente de funcionamiento.
~ The control gear.
~ El punto de polarización del LED en tensión e intensidad
~ Length of use.
~ El equipo de alimentación.
~ El tiempo de uso.
2TKPEKRNGDGJKPF.'&QRGTCVKQP
2.2.- Principio de funcionamiento del LED
The LED diode is a single-direction, semiconductor device,
thus it must always be connected with higher voltage at the
anode than at the cathode.
El diodo LED es un dispositivo semiconductor y unidireccional, por lo que siempre deberá ser conectado con mayor
tensión en el ánodo que en el cátodo.
66
www.elt.es
Typically, a lighting LED diode has a voltage drop of 3
volts, therefore, by applying this voltage between its anode
and cathode, a direct current is produced that will make the
diode light up.
Típicamente, un diodo LED dedicado a la iluminación tiene
una caída de tensión de unos 3 voltios, por tanto, aplicando
esa tensión entre su ánodo y su cátodo, se producirá una
corriente en sentido directo que hará que el diodo se ilumine.
If we try to connect the LED diode in reverse, with a higher
voltage value at the cathode than at the anode, no current
would be produced and thus it would not light up. Moreover,
care must be taken with this type of connection, given that
they are diodes that are generally not designed to withstand
high reverse voltages.
Si tratásemos de conectar el diodo LED al revés, con más
tensión en cátodo que en ánodo, no se establecería corriente, y éste no luciría. Además, hay que tener cuidado con este
tipo de conexión, ya que son diodos que generalmente no están pensados para soportar elevadas tensiones en inversa.
.'&NKIJVKPICFXCPVCIGU
2.3.- Ventajas de la iluminación LED
LED technology has several advantages over conventional lighting systems, such as:
La tecnología LED ofrece varias ventajas frente a los sistemas de iluminación convencionales, como por ejemplo:
~ Long service life that substantially reduces maintenance and replacement costs. It is estimated that at about
QRGTCVKPI JQWTU KVU ƀQY HCNNU DGNQY QH VJG
initial level.
~ Larga vida útil que reduce notablemente los costes de
mantenimiento y reemplazo. Se considera que cerca de
NCUJQTCUUWƀWLQFGECGRQTFGDCLQFGNFGN
inicial.
`*KIJGHſEKGPE[CPFNQYEQPUWORVKQP
NO9/QTGNKIJV
generated per watts used.
`$CLQEQPUWOQ[CNVCGſEKGPEKC
NO92TQFWEGPOC[QT
luz por cada vatio consumido.
~ Greater response speed given that it lights up instantly
CPFYKVJQWVCP[ƀKEMGTKPIQTUVCTVWRVKOG
~ Mayor rapidez de respuesta debido a que su encendido
es instantáneo y sin ningún tipo de parpadeos ni periodos de arranque.
~ Clearer and brighter light. The LED chromatic scale is
purer, thus the light is more natural for the human eye.
~ Luz más nítida y brillante. La escala cromática de los
LEDs es más pura por lo que esta luz es más natural
para el ojo humano.
~ Uni-directional light: The light can be better focused on
the area you want to light up, which means less consumption.
~ Luz unidireccional: La luz puede ser dirigida a la zona
que se desee iluminar con un mayor aprovechamiento,
lo que se traduce en un menor consumo.
~ Wide colour spectrum. LED technology affords us the
choice of a more extensive variety of colours.
~ Amplio espectro cromático. La tecnología LED nos brinda la posibilidad de elegir entre una amplia variedad de
colores.
~ Environmentally-friendly. LED devices do not contain
either mercury or other toxic elements and do not produce either infrared or ultraviolet radiation.
~ Ecológicos. Los dispositivos LED no contienen mercurio
ni otros elementos tóxicos, no producen irradiaciones de
infrarrojos o ultravioletas.
~ Size. Their small dimensions enable the design of more
compact applications.
~ Tamaño. Sus reducidas dimensiones permiten el desarrollo de aplicaciones más compactas.
3.- BASIC LED AND LED MODULE
CONCEPTS
3.- CONCEPTOS FUNDAMENTALES
DEL LED Y MÓDULOS LED
In addition to their electrical characteristics, LEDs possess
QVJGTFGſPKPIRGTHQTOCPEGUVJCVPGGFVQDGMPQYP
Los LEDs, además de las características eléctricas, poUGGP QVTC UGTKG FG RCT¶OGVTQU SWG NQU FGſPGP NCU EWCNGU
hay que conocer:
3.1.- Correlated Color Temperature - CCT
3.1.- Temperatura de
Color Correlacionada - CCT
6JG EQNQWT VGORGTCVWTG ECP DG FGſPGF CU VJG UGPUCVKQP
perceived by the human eye in the presence of light; it is
warm when amber predominates, and cool when blue.
.C VGORGTCVWTC FG EQNQT RWGFG FGſPKTUG EQOQ NC UGPUCción que percibe el ojo humano ante una luz, siendo cálida si
predomina el ámbar o fría si es el azul.
CCT is obtained from comparing the colour within the light
spectrum of a light source with the light of a black body, i.e.
an “ideal radiator” heated to a particular temperature.
www.elt.es
La CCT se obtiene de la comparación del color dentro del
espectro luminoso de una fuente de luz con el de la luz de un
cuerpo negro, es decir un “radiante teórico perfecto” calentándolo a una temperatura determinada.
67
A simple way to understand this is to imagine the range of
colours a piece of metal would pass through when heated;
it would go from red to blue, by way of amber, yellow and
white.
Un ejemplo sencillo para comprenderlo es imaginarse la
gama de colores por la cual pasaría un metal al calentarlo,
los cuales irían desde el rojo al azul, pasando por el ámbar,
amarillo y el blanco.
Colour temperature is measured in degrees Kelvin (K):
La temperatura de color se mide en Grados Kelvin (K):
~ Amber: from 1.200K to 2.400K.
~ Very Warm White: from 2,400K to 2.900K.
~ Warm White: from 2.900K to 3.900K.
~ Neutral White or Daylight: from 3.900K to 5.500K.
~ Cold White: from 5.500K to 7.000K.
~ Very Cold White: from 7.000K to 9.000K.
~ Ámbar: de 1.200K a 2.400K.
~ Blanco Muy Cálido: de 2.400K a 2.900K.
~ Blanco Cálido: de 2.900K a 3.900K.
~ Blanco Neutro o Luz Día: de 3.900K a 5.500K.
~ Blanco Frio: de 5.500K a 7.000K.
~ Blanco Muy Frio: de 7.000K a 9.000K.
1.500K
Amber
2.700K
Very Warm
3.000K
Warm
4.000K
Neutral
5.700K
Frio
8.500K
Very Cold
Ámbar
Muy Cálido
Cálido
Neutro
Cold
Muy Frio
%QNQT4GPFGTKPI+PFGZ%4+
3.2.- Índice de Reproducción
Cromática - CRI
The colour rendering index (CRI - or Ra) measures the
ability of a light source to reproduce the colours of an object
faithfully in comparison with an ideal or natural light source.
It is measured as indicated by the International Commission on Illumination (CIE) 13.3 – Method of measuring and
specifying colour rendering properties of light sources. This
method is applied on a scale of 0 to 100:
4Cŭ8GT[GHſEKGPV5RGEKCNKPFQQTCRRNKECtions.
ŭ4Cŭ'HſEKGPV7UGFKPFQQTU
ŭ4Cŭ0QTOCN7UGFKPFQQTUCPFQWVFQQTU
4C&GſEKGPV7PWUWCNHQTVJKUVGEJPQNQI[
El índice de reproducción cromática (CRI - Color Rendering Index o Ra) mide la capacidad que tiene una fuente luOKPQUCRCTCTGRTQFWEKTſGNOGPVGNQUEQNQTGUFGWPQDLGVQGP
comparación con una fuente de luz natural o real.
.WOKPQWUƀWZ.WOGP
NO
3.3.- Flujo luminoso - Lumen (lm)
Se mide tal como indica la CIE 13.3 - Método de medición
[GURGEKſECEKÎPFGNCURTQRKGFCFGUFGTGPFKOKGPVQFGEQNQT
de las fuentes luminosas. Este método se aplica sobre una
escala del 0 a 100:
4Cŭ/W[GſEKGPVG#RNKECEKQPGUGURGEKCNGU
de Indoor.
4Cŭ'ſEKGPVG7VKNK\CFQGP+PFQQT
ŭ4Cŭ4GIWNCT7VKNK\CFQGP+PFQQT[1WVFQQT
4C&GſEKGPVG0QWUWCNRCTCGUVCVGEPQNQIÈC
6JGNWOKPQWUƀWZKUVJGRQYGTGOKVVGFKPCHQTOQH
light radiation to which the human eye is sensitive.
'NƀWLQNWOKPQUQGUNCRQVGPEKCGOKVKFCGPHQTOC
de radiación luminosa a la que el ojo humano es sensible.
It is measured as the amount of light emitted by a
light source in all directions. Its symbol and SI unit of
measurement is the lumen (lm).
Se mide como la cantidad de luz emitida por una
fuente de luz en todas las direcciones. Su símbolo y
su unidad de medición en el Sistema de Internacional es el lumen (lm).
.WOKPQWUKPVGPUKV[Ō%CPFGNC
EF
3.4.- Intensidad luminosa – Candela (cd)
.WOKPQWUƀWZKUFGſPGFQPVJGDCUKUQHVJGDCUKE
SI unit, the candela (cd).
The candela, also referred to as luminous intenUKV[KUVJGRCTVQHVJGƀWZGOKVVGFD[CNKIJVUQWTEG
in a particular direction given by the solid angle that
contains it.
'N ƀWLQ .WOKPQUQ UG FGſPG C RCTVKT FG NC WPKFCF
básica del Sistema Internacional, la candela (cd).
La candela, o también llamada intensidad luminoUCGUNCRCTVGFGƀWLQGOKVKFQRQTWPCHWGPVGFGNW\
en una dirección dada por el ángulo sólido que lo
contiene.
68
www.elt.es
+NWOKPCPEGŌ.WZ
NOO2)
3.5.- Iluminancia – Lux (lm/m2)
.WOKPQWUƀWZUJQWNFPQVDGEQPHWUGFYKVJCPQVJGT
magnitude: illuminance. The unit by which the latter
is measured is the lux (lm/m2), which represents the
COQWPVQHNWOKPQWUƀWZRGTWPKVCTGCKGVJGFGPUKV[
of the light on a given surface.
0Q JC[ SWG EQPHWPFKT GN ƀWLQ NWOKPQUQ EQP QVTC
magnitud, la iluminancia. La unidad de esta última
es el lux (lm/m2[UGOKFGEQOQNCECPVKFCFFGƀWLQ
NWOKPQUQRQTWPKFCFFGUWRGTſEKGGUFGEKTNCFGPUKFCFFGNW\UQDTGWPCUWRGTſEKGFCFC
.WOKPQWUGHſECE[Ō
NOY
'ſEKGPEKCNWOKPQUCŌ
NOY
.WOKPQWU GHſECE[ QT RGTHQTOCPEG KU VJG TCVKQ QH VJG
amount of light emitted (lm) to the power consumed (W). It is
measured, therefore, in lm/W.
.CGſEKGPEKCNWOKPQUCQTGPFKOKGPVQNWOKPQUQGUNCTGNCción entre la cantidad de luz emitida (lm) y la potencia consumida (W). Se mide por tanto en lm/W.
.WOKPQWUFKUVTKDWVKQPEWTXG
3.7.- Curva de distribución luminosa
The luminous distribution curve is obtained by taking light
intensity measurements at different angles around a light
source. It is normally represented by polar coordinates.
La curva de distribución luminosa es el resultado de tomar
medidas de intensidad luminosa en diversos ángulos alrededor de una fuente lumínica, y se representada normalmente
en coordenadas polares.
The distance from any point on the curve to the centre indicates the light intensity of the source in that direction.
La distancia de cualquier punto de la curva al centro, indica la intensidad luminosa de la fuente en esa dirección.
Generally speaking these curves indicate the maximum
light intensity value in candelas for every 1,000lm.
Generalmente, estas curvas indican el valor máximo de
intensidad luminosa representado en candelas por cada
1.000lm.
ELT provides luminous distribution curves for its LED modWNGUCUWUGTQTNWOKPCKTGOCPWHCEVWTGTKPHQTOCVKQP6JGſPCN
result of the application will depend on system requirements.
www.elt.es
ELT proporciona las curvas de distribución lumínica de los
módulos LED como información para el usuario o fabricante
FGNWOKPCTKCUGNTGUWNVCFQſPCNFGNCCRNKECEKÎPFGRGPFGT¶
de los requisitos del sistema.
69
4.- LED MODULES
4.- MÓDULOS LED
An LED module’s electrical, photometric, luminous and heat performance is determined
by:
El comportamiento eléctrico, fotométrico,
lumínico y térmico de un módulo LED vendrá
determinado por:
~ The LED chosen. At present, the market
offers numerous LED solutions for different applications and with completely different characteristics.
~ El LED elegido. El mercado nos ofrece a
día de hoy múltiples soluciones LED para
diferentes aplicaciones y con características completamente diferentes.
~ The electrical circuit.
~ El circuito eléctrico.
~ System heat management.
~ La gestión térmica del sistema.
4.1.- Selecting an LED – Binning
4.1.- Elección de un LED – Binning
During the LED semiconductor manufacturing process different results arise in its basic parameters. This explains why
manufacturers classify them by bins, as a way to name the
different types or categories obtained within the same type
QH.'&6JGVGUVKPICPFENCUUKſECVKQPRTQEGUUQH.'&UKPVQ
each one of these categories is called binning.
Durante el proceso de fabricación de los semiconductores
LED surgen diferentes resultados en sus parámetros fundaOGPVCNGU 'U RQT GNNQ SWG NQU HCDTKECPVGU NQU ENCUKſECP RQT
bin como una forma de denominar a las diferentes clases
o categorías obtenidas dentro de un mismo tipo de LED. Al
RTQEGUQFGVGUVGQ[ENCUKſECEKÎPFGNQU.'&UGPECFCWPCFG
las categorías se le denomina binning.
$KPENCUUKſECVKQPQTV[RGU
~ Direct Voltage bin.
.CENCUKſECEKÎPQNQUVKRQUFGDKPGU
~ Colour bin.
~ Bin de Tensión Directa.
~ Luminous Flux or Brightness bin.
~ Bin de Color.
~ Bin de Flujo Luminoso o brillo.
This means that the design of the light source or luminaire will have more or less performances depending on the
choice of bin.
'UVQUKIPKſECSWGGNFKUGÌQFGNCHWGPVGFGNW\QNWOKPCTKC
tendrá más o menos prestaciones dependiendo de la elecEKÎPFGNDKPTGCNK\CFQ
The use of a single bin in each category ensures perfect
uniformity.
.CWVKNK\CEKÎPFGWPÕPKEQDKPGPECFCWPCFGNCUECVGIQrías asegura una perfecta uniformidad.
4.2.- Elipses de MacAdam - SDCM
4.2.- MacAdam ellipses - SDCM
Dentro de una misma temperatura
de color podemos encontrarnos con
diferentes tonalidades o uniformidades de color, por lo que ésta no nos
RTQRQTEKQPC KPHQTOCEKÎP UWſEKGPVG
Son las llamadas elipses de MacAFCONCUSWGECTCEVGTK\CPNCJQOQIGneidad del color.
9G ECP ſPF FKHHGTGPV EQNQWT VQPGU
or uniformities within the same colour
temperature, consequently this fails to
provide us with enough information.
These are the so-called MacAdam
ellipses that characterise colour uniformity.
These ellipses are represented in
the chromaticity diagram and we can
come across different sizes, as can be
UGGPHTQOVJGHQNNQYKPIſIWTG
Estas elipses se representan dentro del diagrama cromático y nos
podemos encontrar con diferentes
VCOCÌQU VCN [ EQOQ OWGUVTC NC UKIWKGPVGſIWTC
70
www.elt.es
The measurement scale for these ellipses is determined
by the standard deviation of the colour matching (SDCM –
Standard Deviation of Color Matching).
La escala de medición de estas elipses viene determinada por la desviación estándar de combinación de colores
(SDCM – Standard Desviation of Color Matching).
Module colour uniformity is measured by tracing different
ellipses around the quadrant of the chosen colour temperature. The SCDM number is determined by the ellipse that
contains all the colour bin values used in the module.
La forma de medida de la uniformidad de color del módulo
se realiza trazando las diferentes elipses entorno al cuadrante de la temperatura de color elegida. El número de SCDM
vendrá determinado por aquella elipse que contenga todos
los valores de bines de color empleados en el módulo.
1 - 7 SDCM or steps MacAdam Ellipses
1 - 7 SDCM o pasos de Elipses de MacAdam
4000K
3500K
4500K
1 SDCM
or STEP
Therefore, the smaller the ellipse the less colour deviation
obtained. Generally speaking, it can be said that the human
G[GTGURQPFUVQVJGHQNNQYKPIENCUUKſECVKQP
De modo que cuanto menor es el tamaño de la elipse menor desviación de color se obtendrá. De una forma general
se puede decir que el ojo humano responde a la siguiente
ENCUKſECEKÎP
~ 1 SDCM: There are no colour differences.
~ 1 SDCM: No existen diferencias de color.
~ 2 – 4 SDCM: There is hardly any visible difference.
~ 2 – 4 SDCM: Apenas existe una diferencia visible.
~ 5 or more SDCM: Colour is easily perceived.
~ 5 o más SDCM: Es fácilmente perceptible.
'NGEVTKECNEKTEWKV
4.3.- Circuito eléctrico
When it comes to designing an LED module, the baseline
TGSWKTGOGPVUOWUVſTUVDGGUVCDNKUJGF6JGUGCTGPQTOCNN[
electrical in nature: voltage and current and photometric features: Lumens. The outcome and resulting quality will be determined both by LED distribution within the module, as well
as by their electrical connection.
#NCJQTCFGFKUGÌCTWPOÎFWNQ.'&JC[SWGKFGPVKſECTNQU
requisitos de partida. Estos normalmente suelen ser eléctricos: tensión y corriente, y fotométricos: Lúmenes. Los resultados y calidad resultante vendrán determinados tanto por
la distribución de los LEDs dentro del módulo como por su
conexión eléctrica interna.
In Constant Current-powered LED modules, the internal
electrical connection is based on interlinking LEDs serially
forming a branch. The connecting of several branches in parallel goes to make up the LED module.
En los módulos LED alimentados en Corriente Constante
el conexionado eléctrico interno está basado en la concatenación de LEDs en serie formando una rama, la conexión en
RCTCNGNQFGXCTKCUTCOCUEQPſIWTCPGNOÎFWNQ.'&
www.elt.es
71
Module output voltage
Tensión de salida del módulo
The number of LEDs connected in series that are connected by each branch determines the module’s output voltage,
given that this is the sum of the direct voltages at each one
of LEDs (VTOTAL = VLED_1 + VLED_2 + … + VLED_N).
El número de LEDs en serie que se conectan por cada
rama determina la tensión de salida del módulo, ya que esta
es la suma de las tensiones en directa de cada uno de los
LEDs (VTOTAL = VLED_1 + VLED_2 + … + VLED_N).
Therefore, the output voltage will depend on the voltage
bin chosen. Important dispersions as a result of not choosing the voltage bin properly can make the independent LEDs
work in an unbalanced manner causing disparate heating
and thus shortening their useful life.
Por tanto, la tensión de salida dependerá del bin de tensión elegido. Dispersiones importantes por no realizar una
adecuada elección del bin de tensión, puede hacer trabajar
desequilibradamente a los LEDS independientes provocando calentamientos dispares acortando su esperanza de vida.
The current circulating through each LED is equal to the
input current (IIN) divided by the number of branches (ILED =
IIN / No. branches).
La corriente que circula por cada LED es igual a la corriente de entrada (IIN) divida por el número de ramas (ILED = IIN
/ Nº ramas).
6JGOQFWNGOCPWHCEVWTGTFGſPGUVJGKPRWVEWTTGPV
+IN) in
accordance with the number of branches, based on the fact
that each LED type has a typical operating current, determined by the LED manufacturer in order to ensure:
'NHCDTKECPVGFGNOÎFWNQFGſPGNCEQTTKGPVGFGGPVTCFC
+IN)
en función del número de ramas, basándose en que cada
tipo LED posee una corriente típica de funcionamiento, determinada por el fabricante del LED para asegurar:
~ Service life prolongation, given that the lower the current
VJCVƀQYUVJTQWIJVJG.'&VJGNQYGTKVUVGORGTCVWTG
~ Alargar su vida útil, ya que, la temperatura del LED es
menor cuanto menor es la corriente que lo atraviesa.
~ The desired colour and luminosity. If powered at a different current these two parameters will be altered.
~ Obtener la luminosidad y color deseados. Si se alimenta
a una corriente diferente estos dos parámetros se verán
OQFKſECFQU
4.4.- Heat management
4.4.- Gestión térmica
Special attention must be paid to the luminaire’s heat results to use the LED modules properly. Good heat management based on proper module design and good arrangement
CPFſVVKPIKPVQVJGNWOKPCKTGOCMGKVRQUUKDNGVQCEJKGXGOCZimum reliability and optimal functioning.
Para un correcto uso de los módulos LED, es necesario
prestar especial atención a los resultados térmicos de la luminaria. Una buena gestión térmica basada en un correcto
diseño del módulo y de una buena disposición y montaje en
NCNWOKPCTKCRGTOKVKT¶PCNECP\CTNCO¶ZKOCſCDKNKFCF[GNÎRtimo funcionamiento.
6JGCODKGPVVGORGTCVWTGKPRCTVKEWNCTGZGTVUCFKTGEVKPƀWGPEGQPVJGGHſEKGPE[QHVJGU[UVGOCPFVJGCXGTCIGNKHGQH
the modules. It can even directly affect the colour temperature and appearance of the light emitted.
'URGEKCNOGPVGNCVGORGTCVWTCCODKGPVGVKGPGWPCKPƀWGPEKCFKTGEVCGPNCGſECEKCFGNUKUVGOC[NCXKFCOGFKCFGNQU
módulos, incluso puede incidir directamente sobre la temperatura de color y apariencia de la luz emitida.
72
www.elt.es
The temperature of the modules basically depends on:
La temperatura de los módulos depende básicamente de:
~ The operating temperature of the LED diode itself, Tj or
the junction temperature. This will be higher depending
QPJQYPGCTVJGEWTTGPVVJCVƀQYUVJTQWIJKVCRRTQCEJGU
the maximum value admitted by the module.
~ La temperatura de funcionamiento del propio diodo LED,
Tj ó temperatura de la unión. Esta será más alta a medida que la intensidad eléctrica que lo atraviesa se acerque al valor máximo permitido por el módulo.
~ The ambient temperature, Ta, that surrounds the module.
~ La temperatura ambiente Ta que rodea al módulo
~ La disipación térmica entre el módulo y la luminaria o
apoyo dentro de ella.
~ The heat dissipation between the module and the luminaire or support inside it.
To facilitate correct user interpretation and application,
'.6 FGſPGU VJG 6E RQKPV QT VGUV RQKPV KPUKFG VJG OQFWNG KP
order to enable a quick evaluation of the system’s heat result.
Para facilitar al usuario la interpretación y correcta apliECEKÎP '.6 FGſPG GN RWPVQ 6E Q RWPVQ FG VGUV FGPVTQ FGN
módulo para que de una forma rápida, se pueda evaluar el
resultado térmico del sistema.
We recommend that you measure the temperature at the
module’s Tc point and make sure that this is not exceeded,
otherwise its useful life will be reduced exponentially. Values
below this point considerably increase the service life of the
LEDs.
Recomendamos medir la temperatura en el punto Tc del
módulo y que esta no sea superada, de lo contrario su esperanza de vida se verá mermada de forma exponencial. Valores por debajo de este punto aumenta considerablemente la
vida de los LEDs.
<JCIC%QPUQTVKWO
4.5.- Zhaga Consortium
LED is a practically new technology that knows no
limits in terms of size, shape, performance and type of
KPVGTEQPPGEVKQP6JKUCNNQYUHQTCJKIJFGITGGQHƀGZibility and creativity; Nevertheless, given there are no agreed
URGEKſECVKQPU VJKU ECP ECWUG EQPHWUKQP QP VJG OCTMGV CPF
a lack of interoperability between LED manufacturers’ products.
Los LEDs son una tecnología prácticamente nueva
que no tiene casi ningún tipo de limitaciones en cuanto
a tamaño, forma, rendimiento y tipo de interconexión.
'UVQRQUKDKNKVCWPCNVQITCFQFGƀGZKDKNKFCF[ETGCVKXKFCFUKP
GODCTIQGPCWUGPEKCFGGURGEKſECEKQPGUCEQTFCFCURWGde ocasionar confusión en el mercado y una falta de interoperabilidad entre fabricantes de productos LED.
As a result, several lighting sector companies around the
world ( ELT included) have set up a consortium called ZHAGA, which provides stable design platforms for LED modules
with a view to ensuring the interchangeability of LED light
emitters.
Por ello, varias empresas del sector de la iluminación de
todo el mundo (incluyendo ELT) han formado un consorcio
llamado ZHAGA, el cual proporciona plataformas estables
de diseño para los módulos LED con el objetivo de garantizar una intercambiabilidad de emisores de luz LED.
www.elt.es
73
5.- CONTROL GEARS
5.- FUENTES DE ALIMENTACIÓN
After we establish the direct current through an LED diode,
we must take care to avoid exceeding the limits set by the
LED diode manufacturer. In other words, we will have to limit
VJKUEWTTGPVVQCXQKFQWTU[UVGOYQTMKPIKPGHſEKGPVN[CPFUWHfering damage. The question is, how can we limit the current
through our chain or strip of LED diodes? The solution lies in
a piece of equipment commonly referred to as a control gear
or driver, which is designed for ‘constant voltage’ or ‘constant
current’ applications.
Una vez que establecemos una corriente directa a través
de un diodo LED, debemos ser cuidadosos en no superar
los límites establecidos por el fabricante de diodos LED. En
otras palabras, tendremos que limitar esa corriente para que
PWGUVTQ UKUVGOC PQ UGC KPGſEKGPVG [ CFGO¶U PQ UWHTC FCños. La pregunta es, ¿cómo limitamos la corriente a través
de nuestra cadena de diodos LED? La solución es un equipo
de control denominado comúnmente fuente de alimentación
o driver, diseñado para aplicaciones de ‘tensión constante’ o
‘corriente constante’.
5.1.- Constant voltage control
5.1.- Control por tensión constante
En este método, la fuente de alimentación de
In this method, the LED diodes control gear sup- Constant Voltage
plies a constant and unchanging output voltage, re- Tensión Constante los diodos LED, suministra una salida de tensión
constante e invariable, independientemente de la
gardless of the connected load.
v
carga conectada.
CV
-
If we connect a chain of LED diodes and estabNKUJCEWTTGPVVQƀQYVJTQWIJVJGOVJGTGYQWNFDG
no element to limit the current, could cause damages in our equipments. For avoiding this, a resistor
is placed on each branch or chain of diodes connected in serie. Accordingly, on having a constant
voltage in the resistor, a constant current will be
established through it, therefore, though the LED
diodes.
Si conectásemos una cadena de diodos LED,
y se estableciese corriente a través de ellos, no
habría ningún elemento que limitase la corriente, llegando a poder producir daños en nuestro
equipo. Para ello, se introduce una resistencia en
cada rama o cadena de diodos en serie. De esta
manera, al tener una tensión constante en bornes
FGNCTGUKUVGPEKCUGſLCT¶WPCEQTTKGPVGEQPUVCPVG
a través de la resistencia y, por tanto, a través de
los diodos LED.
LED diodes are conducting 100% of the time. Given that
C EWTTGPV ƀQYU VJTQWIJ VJG TGUKUVQTU VJGTG YKNN DG NQUUGU
caused by heat dissipation, thus creating a system that is
PQVCUGHſEKGPVCUCRTQOKUKPIVGEJPQNQI[NKMG.'&NKIJVKPI
should be.
Los diodos LED están conduciendo el 100% del tiempo,
eso sí, al circular una corriente por las resistencias, se producirán pérdidas por disipación en forma de calor, dando como
TGUWNVCFQWPUKUVGOCPQVCPGſEKGPVGEQOQFGDGTÈCUGTWPC
tecnología tan prometedora como es la iluminación LED.
You must also bear in mind that if you are using electronic
or electromagnetic transformers to provide a constant voltage, the LED diodes will conduct 50% of the time and, what
is more, in the case of high frequency electronic transformers, we will get important current variations on the LED diodes, which may cause unwanted heating.
También hay que tener en cuenta que si se usan transformadores electrónicos o electromagnéticos para proporcionar
una tensión constante, los diodos LED conducirán el 50%
del tiempo y, además, en el caso de los transformadores
electrónicos de alta frecuencia, tendremos unas variaciones
de corriente importantes en los diodos LED, pudiendo dar
como resultado calentamientos indeseados.
5.2.- Constant current control
5.2.- Control por corriente constante
En este método de control, nuestro ‘driver’ sumiIn this control method, our driver will supply a Constant Current
constant current through the LED module, thus en- Corriente Constante PKUVTCT¶WPCEQTTKGPVGEQPUVCPVGSWGƀWKT¶CVTCXÃU
del módulo LED, haciendo que la luminosidad en
suring uniform luminosity in all of them. The output
v
todos ellos sea la misma. La tensión en la salida
voltage will be established by the number of LED
XGPFT¶ſLCFCRQTGNPÕOGTQFGFKQFQU.'&EQPGEdiodes connected.
tados.
6JGTGKUPQPGGFVQſVTGUKUVQTUVQſZVJGEWTTGPV
En este método no es necesaria la instalación
in this method, so we avoid unnecessary losses.
FGTGUKUVGPEKCUFGſLCEKÎPFGEQTTKGPVGRQTVCPVQ
Thus, our system becomes much OQTGGHſEKGPV.
evitamos pérdidas innecesarias. Así, nuestro sistema se convierte en uno mucho O¶UGſEKGPVG.
-
CC
The LED diodes will be conducting 100% of the
VKOGCPFVJGUCOGEWTTGPVYKNNƀQYVJTQWIJVJGO
thus producing the same luminosity in each one.
Accordingly, the ‘Constant current control’ method
represents the best lighting solution.
+
-
74
Los diodos LED estarán conduciendo el 100%
FGNVKGORQ[CVTCXÃUFGGNNQUƀWKT¶NCOKUOCEQrriente, produciendo la misma luminosidad en todos ellos. De esta manera, el método de ‘Control
en corriente constante’ se convierte en la solución
óptima para la iluminación.
www.elt.es
5.3.- Constant current control gear
5.3.- Fuente de alimentación de
corriente constante
A control gear or driver is a device that enables the conversion of mains energy to the form required by the load in the
OQUVGHſEKGPVOCPPGTRQUUKDNG6JGRQYGTFGNKXGTGFVQVJG
load is always less than that demanded from the mains owing to the losses produced in any device of this type, which
are converted into heat. Ensuring that this power loss is as
little as possible is the aim of any control gears manufacturer,
KGVQIGVCUENQUGCURQUUKDNGVQGHſEKGPE[
Una fuente de alimentación o driver es un dispositivo que
permite la conversión de energía desde la red a la forma
TGSWGTKFCRQTNCECTICFGNCOCPGTCO¶UGſEKGPVGRQUKDNG
La energía que se entrega a la carga siempre es menor que
la demandada a la red, debido a las pérdidas que se originan
en cualquier dispositivo de este tipo y que se convierten en
calor. Conseguir que esa pérdida de energía sea la menor
posible es la meta de cualquier fabricante de fuentes de alimentación, es decir, acercarse lo más posible a un 100% de
GſEKGPEKC
In the case of a control gear for LEDs, normally the mains
alternating current (AC) is converted into direct current (DC),
thus we are talking of AC/DC converters. In addition to an
'/+ſNVGTCPFDTKFIGTGEVKſGTKPUKFGKVVJGTGOC[DGQPGQT
several intermediate stages that gradually transform the
power to meet our requirements at any moment in time.
En el caso de una fuente de alimentación para LEDs, normalmente se convierte la energía alterna de la red (AC) en
energía continua en la salida (DC), y hablamos de converVKFQTGU#%&%&GPVTQFGNOKUOQCFGO¶UFGWPſNVTQ'/+
[ WP RWGPVG TGEVKſECFQT RWGFG JCDGT WPC Q XCTKCU GVCRCU
intermedias que van transformando la energía a los requerimientos que necesitamos en cada momento.
A control gear can be designed with one or several stages.
The number of the stages will determine the features of the
GSWKROGPVGHſEKGPE[QWVRWVTKRRNGEWTTGPVRQYGTHCEVQTGVE
Una fuente de alimentación puede estar diseñada con una
o varias etapas intermedias. El número de éstas determinará
NCURTGUVCEKQPGUFGNGSWKRQGſEKGPEKCTK\CFQFGNCEQTTKGPVG
en la salida, factor de potencia etc…
5KPING5VCIGEQPXGTVGTU
UWKVCDNGHQTNQYRQYGTNGXGNU
5.3.1.- Convertidores de una etapa o Single-Stage
(adecuados para potencias bajas).
This type of control gears uses a power stage converter.
Equipment based on Flyback technology with two coupled
windings would be an example. In one cycle the winding is
charged with power, and in the other one the winding discharges in the secondary, delivering power to the load and
recharging the output capacitors, thus maintaining constant
voltage and current.
Este tipo de fuentes de alimentación utilizan una etapa
conversora de energía. Un ejemplo sería un equipo basado en topología Flyback con dos bobinas acopladas. En un
ciclo, la bobina se carga de energía, y en el otro ciclo, la
bobina se descarga en el secundario, entregando energía a
la carga y recargando los condensadores de la salida y que
mantienen la corriente y tensión constantes.
Aislamiento
Filtro
Red
Mains
Rectificador
Filtro salida
EMI
Filter
DC
Output filter
Rectifier
Isolation
www.elt.es
Módulos LED
LED modules
DC
75
Ciclo de carga
Charge cycle
Ciclo de descarga
Discharge cycle
OUTPUT
VDS
OUTPUT
VDS
The coupling between these two windings is essential to
determining the type of power source isolation:
El acoplamiento entre estas dos bobinas es clave para determinar el tipo de aislamiento de la fuente de alimentación:
~ ISOLATED: When there is galvanic and electrical separation between the primary circuits or mains input and
secondary or load output.
~ AISLADA: Cuando hay una separación galvánica y eléctrica entre los circuitos de primario o entrada de red y
secundario o salida a la carga.
~ INDEPENDENT use: When, in addition to the isolation,
there is double protection between the person and any
accessible live part of the equipment.
~ De uso INDEPENDIENTE: Cuando además del aislamiento, hay una doble protección entre las personas y
cualquier parte activa accesible del equipo.
~ CLASS II: When, moreover, there is double protection
between primary and secondary and between these and
the exterior.
~ CLASE II: Cuando además hay una doble protección entre primario y secundario y desde estos al exterior.
~ Safety Extra Low Voltage (SELV): in the event of complying with the aforementioned requirements, as well as
others concerning voltage values at the output and its
ripple.
~ SELV: en caso de cumplir los anteriores requisitos, así
como otros referidos a los valores de tensión en la salida
y su rizado.
En una etapa Flyback sin etapas reguladoras previas, la
cantidad de energía entregada a la carga es dependiente de
la cantidad de energía en la entrada (tensión de alimentación). Estos equipos suelen tener un rizado mayor, aunque si
éste no supera el 30% se considera que el comportamiento
es bueno.
In a Flyback stage without prior regulating stages, the
amount of power delivered to the load depends on the
amount of input power (power voltage). This equipment normally has a bigger ripple, though if this does not exceed 30%,
behaviour is considered to be good.
OUTPUT
INPUT
OUTPUT
max
RMS
FLYBACK
min
% ripple =
max
-
min
x 100
RMS
The ripple can be compensated for by the electrolytic capacitors acting as components that store energy. This is why
if we connect an LED module to a control gear previously
connected to the mains, these capacitors will remain loaded,
generating, upon connection of the module, high peak intensities which can damage the LEDs. This fact is of vital importance, thus you are advised to check the connections at the
LED modules to avoid bad contacts.
El rizado puede ser compensado por los condensadores
electrolíticos que actúan como componentes que almacenan
energía, por este motivo, si conectamos un módulo LED a
una fuente de alimentación previamente conectada a la red,
estos condensadores permanecerán cargados generando
en el momento de la conexión del módulo intensidades de
pico elevadas que pueden dañar los LED, este hecho es de
vital importancia y se aconseja que se revisen las conexiones en los módulos LEDs para evitar falsos contactos.
PK
Módulo LED
LED module
Owing to the fact that the stage gradually adapts itself, and
in accordance with the mains input values, the power factor
of this type of equipment is normally good >0.9 and the total
JCTOQPKEFKUVQTVKQP
6*&NQY)QQFGHſEKGPE[HQTC(N[back lies between 85 and 90%.
Debido a que la etapa va adecuándose y siguiendo a los
valores de red de entrada, el factor de potencia de este tipo
FGGSWKRQUUWGNGUGTDWGPQ [GN6*&QHCEVQTFGFKUVQTUKÎP CTOÎPKEC DCLQ 7PC DWGPC GſEKGPEKC RCTC WP
Flyback se sitúa entre el 85 y 90%.
76
www.elt.es
+PVGTOGFKCT[UVCIGEQPXGTVGTU
UWKVCDNGHQTJKIJCPFXGT[JKIJRQYGTNGXGNU
5.3.2.- Convertidores de varias etapas intermedias
(adecuados para potencias altas y muy altas).
These types of control gears use several stages to gradually adapt the power to the most suitable characteristics
KP QTFGT VQ CEJKGXG IQQF GHſEKGPE[ CPF JKIJ RGTHQTOCPEG
0QTOCNN[VJGTGKUCſTUVUVCIGVQCEVKXGN[EQTTGEVVJGRQYGT
factor, in addition to generating a continuous voltage bus
that supplies the Flyback. In this way, the power factor is extremely high >0.95, the THD can be controlled and made as
low as possible, the Flyback delivers a constant power at the
output, regardless of the supply voltage
Este tipo de fuentes utilizan varias etapas para ir adecuando la energía a las características más convenientes, para
lograr altas prestaciones y un buen rendimiento. Lo usual
es disponer de una primera etapa de corrección activa del
factor de potencia, generando además un bus de tensión
continua que alimenta al Flyback. De esta manera, el factor
FG RQVGPEKC GU CNVÈUKOQ GN 6*& RWGFG EQPVTQNCTUG [
hacerlo lo más bajo posible, el Flyback entrega a la salida
una energía constante independientemente de la tensión de
alimentación.
Aislamiento
Filtro
Red
Mains
Rectificador
Filtro salida
PFC
Boost
EMI
400V
FLYBACK
Output filter
Rectifier
Filter
Isolation
In this type of control gears a semi-resonant stage is normally used, as the Flyback is quasi-resonant, with a view to
KORTQXKPIGHſEKGPE[6JKUVQRQNQI[KUXGT[UKOKNCTVQVJGPQTmal Flyback, but avoids unnecessary losses by switching at
VJGUCOGVKOGCUVJGYKPFKPIKUNGHVYKVJQWVRQYGT'HſEKGPcies of over 90% can be achieved.
'PGUVGVKRQFGHWGPVGUFGCNKOGPVCEKÎP[EQPGNſPFGOGLQTCTNCGſEKGPEKCUGUWGNGWVKNK\CTWPCGVCRCUGOKTTGUQPCPVG
EQOQNQGUGNƀ[DCEMEWCUKTTGUQPCPVG'UVCVQRQNQIÈCGUOW[
parecida al Flyback habitual, pero evita pérdidas innecesarias al conmutar en el mismo momento en el que la bobina
UGSWGFCUKPGPGTIÈC5GRWGFGPNNGICTCQDVGPGTGſEKGPEKCU
superiores al 90%.
FLYBACK QR
FLYBACK
VDS
Pérdidas
Losses
$CUKEEQPVTQNIGCTRTQVGEVKQP
5.3.3.- Protecciones básicas de una fuente de
alimentación
A control gear must be capable of withstanding abnormal
operating situations without damaging the equipment. Some
of these are:
Una fuente de alimentación debe ser capaz de enfrentarse
a situaciones anormales de funcionamiento sin que ello suponga daño al equipo. Algunas de ellas son:
5KVWCVKQPSituación
Short circuit at output terminals
Cortocircuito en los bornes
de salida
Open circuit at output terminals
Circuito abierto en los bornes
de salida
#EVKQPActuación
Disabling of the system or the capacity to regulate in the event of failure.
Whatever the case, equipment connected against short circuit connections must be capable of withstanding this situation for prolonged
periods and of operating properly after the reason causing the fault situation has been remedied.
Inhabilitación del sistema o bien capacidad para regular en caso de fallo.
En todo caso, un equipo protegido contra conexión en cortocircuito debe ser capaz de soportar prolongadamente esta situación y de funcionar correctamente una vez haya desaparecido la condición de fallo.
Disabling of the system and capacity to reset after the fault situation has been remedied.
Inhabilitación del sistema y capacidad de rearme una vez haya desaparecido la condición de fallo.
Power source high temperatures. Tc higher than indicated
Disconnecting of one of the mains phases or disabling of the system until a suitable temperature is restored for equipment operation. There
KUCNUQVJGRQUUKDKNKV[QHWUKPIVJGTOCNHWUGYJGVJGTTGUGVVCDNGQTPQVQTGXGPQHTGFWEKPIVJGNWOKPQWUƀWZVQRTQFWEGNGUUJGCVKPI
Temperaturas altas en la fuente de alimentación. Tc superior
al indicado
Desconexión de una de las fases de alimentación o inhabilitación del sistema hasta que se recupere una condición de temperatura adecuaFCRCTCGNVTCDCLQFGNGSWKRQ6CODKÃPGZKUVGNCRQUKDKNKFCFFGWUCTHWUKDNGUVÃTOKEQUTGVQTPCDNGUQPQQKPENWUQFKUOKPWKTGNƀWLQNWOÈPKEQ
para favorecer un menor calentamiento.
High temperatures in the LED
module
#PGZVGTPCN06%ſVVGFVQVJG.'&OQFWNGECPKPHQTOVJGEQPVTQNIGCTQHVJGVGORGTCVWTGTGCEJGFKPVJG.'&UCPFCEVCEEQTFKPIN[KHKVIGVU
FCPIGTQWUTGIWNCVKPIVJGNGXGNQHEWTTGPVƀQYKPIVJTQWIJVJG.'&UQTGXGPFKUCDNKPIVJGU[UVGO
Temperaturas altas en el
módulo de LED
Una NTC externa colocada en el módulo de LED puede ofrecer a la fuente de alimentación conocimiento de la temperatura alcanzada en
los LEDs, y de esta manera, actuar si llega a ser peligrosa, regulando el nivel de intensidad a través de los LEDS o incluso inhabilitando el
sistema.
Sudden input voltage
variations
(KVVKPIQHRTQVGEVKQPVQKPVGTPCNRQYGTQHVJGEQPVTQNIGCTCICKPUVVTCPUKGPVXQNVCIGUWTIGUKPQTFGTVQſNVGTFCPIGTQWUXQNVCIGGXGPVUUWEJCU
those generated on the mains by lightning.
Variaciones bruscas de tensión
en la entrada
+PEQTRQTCEKÎPGPNCCNKOGPVCEKÎPKPVGTPCFGNCHWGPVGFGCNKOGPVCEKÎPFGRTQVGEVQTGUEQPVTCUQDTGVGPUKQPGUVTCPUKVQTKCUEQPGNſPFGſNVTCT
eventos de tensión peligrosos como pueden ser los generados sobre una red eléctrica por los rayos.
www.elt.es
77
.KIJVKPITGIWNCVKQPCPFEQPVTQN
systems
5.4.- Sistemas de regulación y control del
alumbrado
Lighting regulation and control systems are a key issue for
a modern society’s lighting.
Hablar de sistemas de regulación y control del alumbrado
es hablar del alumbrado de una sociedad moderna.
Under the premise of smart light use, these systems offer a
lighting that adapts to the needs of each installation and situation, creating suitable ambiences for all times and providing
both a high degree of comfort as well as considerable cost
savings.
Bajo la premisa de un uso inteligente de la luz, estos sistemas ofrecen un alumbrado que se adapta a las necesidades
de cada instalación y situación, creando ambientes adecuados para cada momento y proporcionando tanto un alto grado de confort como un elevado ahorro de energía.
The energy saving made possible by these lighting regulation and control systems, in addition to the economic saving, has an extremely positive effect on the environment,
given that less power consumption means both a reduction
of CO2 emissions as well as a sustainable use of the natural
resources and power sources, thus contributing to environment conservation.
El ahorro de energía que proporcionan los sistemas de
regulación y control del alumbrado, además del ahorro económico, tiene un efecto muy positivo desde el punto de vista
ecológico, ya que el menor consumo de energía supone tanto la reducción de emisiones de CO2 como un uso sostenible
de los recursos naturales y las fuentes de energía, preservando de esta forma el medioambiente.
4GIWNCVKQPOGVJQFU
5.4.1.- Métodos de regulación
Leading & trailing edge dimming
4GIWNCEKÎPRQTTGEQTVGCNKPKEKQQCNſPCNFGHCUG
(leading & trailingedge dimming)
This type of regulation is accomplished without
any need for an additional control wire. It involves
connecting a regulator in series between one of the
mains wire and the equipment.
L
+
Driver
N
-
Este tipo de regulación se realiza sin necesidad
de una línea de control adicional, conectando un
regulador en serie entre la línea de alimentación y
el equipo.
The regulator cuts part of the mains voltage sinusoidal
waveform to a greater or lesser extent in order to regulate
NWOKPQWUƀWZHTQOVQ
El regulador recorta parte de la onda sinusoidal de la tensión de red en mayor o menor medida para obtener una reIWNCEKÎPFGƀWLQNWOÈPKEQGPVTGGN
Depending on how the mains voltage cut is made, it is possible to distinguish between two types of regulation:
Dependiendo como se realiza el recorte de la tensión de
red se puede distinguir entre dos tipos de regulación:
.GCFKPIGFIGFKOOKPI
Regulación al inicio de fase (Leading-edge dimming):
Regulation by means of cut-off in the wave on
its rising side, from the beginning (phase cut-off at
ignition). This is habitually used in halogen lamps
supplied through electromagnetic transformers
Leading-edge dimming or cut-on
(recorte por inicio de fase)
Regulación mediante recorte de la onda de red
GP UW ƀCPEQ FG UWDKFC FGUFG GN KPKEKQ EQTVG FG
fase en el encendido). Es el empleado habitualmente en lámparas halógenas alimentadas a través
de transformadores electromagnéticos.
4GIWNCEKÎPCſPCNFGHCUG
6TCKNKPIGFIGFKOOKPI
6TCKNKPIGFIGFKOOKPI
Regulation by means of cut-off in the wave on its
descending side, from the end cutting backwards
(phase cut-off at switch off). This is the most suitable for halogen lamps supplied through electronic
transformers .
Trailing-edge dimming or cut-off
(recorte por final de fase)
Regulación mediante recorte de la onda de red
GP UW ƀCPEQ FG DCLCFC FGUFG GN ſPCN TGEQTVCPFQ
hacia atrás (corte de fase en el apagado). Es más
adecuado para lámparas halógenas alimentadas a
través de transformadores electrónicos.
Existen diversos reguladores y equipos que soportan ambos tipos de regulación, y otros que solo soportan
uno de ellos.
There are regulators and equipment that support both
types of regulation, and others that support only one type.
In the marking of these systems with phase cutting regulation you can see indications of what type of cut is involved:
En el marcaje de estos sistemas con regulación por recorte de fase, se pueden observar indicaciones que informan
del tipo de recorte:
LC
Leading & Trailing-edge dimming
4GIWNCEKÎPEQPTGIWNCFQTFGEQTVGCNKPKEKQ[QCNſPCNFGHCUG
L
Leading-edge dimming
Regulación con regulador de corte al inicio de fase
C
Trailing-edge dimming
4GIWNCEKÎPEQPTGIWNCFQTFGEQTVGCNſPCNFGHCUG
78
www.elt.es
1-10V regulation
Regulación 1-10V
6JG8U[UVGOGPCDNGUTGIWNCVKQPQHVJGNWOKPQWUƀWZ
from around 1% to 100% by means of an analogue signal to
the equipment over an additional, two-wire additional control
line. These control wires have positive and negative polarities respectively and must be borne in mind when wiring up
the system.
'NUKUVGOC8RGTOKVGNCTGIWNCEKÎPFGNƀWLQNWOKPQUQ
entre alrededor del 1 y el 100%, mediante una señal analógica que llega a los equipos a través de una línea de control
adicional de dos hilos. Estos hilos de control poseen una
polaridad positiva y negativa respectivamente que hay que
respetar a la hora de realizar el cableado.
The analogue signal has a direct voltage value of 1V to
10V. Minimum light is obtained 1V or by short circuiting the
equipment’s input control, while maximum light level is obtained 10V or by leaving the input control circuit open.
La señal analógica tiene un valor de tensión continua entre 1V y 10V, obteniéndose el nivel mínimo de luz con 1V o
cortocircuitando la entrada de control del equipo, y el máximo nivel de luz con 10V o dejando la entrada de control en
circuito abierto.
The line control only enables regulation of the luminous
ƀWZVJGUYKVEJKPIQPCPFVJGUYKVEJKPIQHHQHVJGNKIJVYJKEJ
ECPVCMGRNCEGCVCP[TGIWNCVKQPRQKPV+VKUFQPGD[ſVVKPIC
switch on the equipment’s power line. Both lines, the control
and power one, are electrically separated from each other.
Mediante la línea de control solo se puede realizar la reguNCEKÎPFGNƀWLQNWOKPQUQGNGPEGPFKFQ[GNCRCICFQFGNCNW\
que puede tener lugar en cualquier punto de la regulación,
se realiza mediante un interruptor colocado en la línea de alimentación del equipo. Ambas líneas, la de control y la de alimentación, se encuentran separadas eléctricamente entre sí.
La curva de regulación que representa la relación entre la
VGPUKÎPGPNCNÈPGCFGEQPVTQN[GNƀWLQNWOKPQUQGUV¶FGſPKFC
por la norma internacional IEC 60929 y muestra una relación
prácticamente lineal en el rango de 3V a 10V.
The regulation curve that represents the relationship beVYGGP VJG EQPVTQN NKPG XQNVCIG CPF VJG NWOKPQWU ƀWZ KU FGſPGFD[VJGKPVGTPCVKQPCNUVCPFCTF+'%CPFTGƀGEVUC
practically lineal relationship in the range of 3V to 10V.
To get a response adapted to that of the human eye it is
possible to use logarithmically controlled potentiometers.
100
80
60
40
20
0
0
1
2
3
5
6
7
8
9
10
Para obtener una respuesta adaptada a la respuesta del
ojo humano, se pueden usar potenciómetros de control logarítmicos.
Power control is generated by these in lighting equipment
with 1-10V regulation. A current is supplied to the controller
by means of equipment control terminals. The controller current must be from 10uA to 2mA. The maximum control line
current is obtained with a voltage of 1V and the minimum with
a voltage of 10V.
En los equipos de iluminación con regulación 1-10V, la
potencia de control es generada por éstos. A través de los
bornes de control del equipo, se suministra una corriente al
controlador que debe estar comprendida entre 10uA y 2mA.
La máxima corriente por la línea de control se obtiene con la
tensión de 1V y la mínima corriente con 10V.
This regulation system is unidirectional, i.e. the information
ƀQYUKPQPGFKTGEVKQPHTQOVJGEQPVTQNNGTVQVJGNKIJVGSWKRment. The latter generates no type of feedback to control. It
does not allow for addressing by means of equipment software. Groups have to be created by wiring. This system can
be integrated into building control systems.
Este sistema de regulación es unidireccional, es decir la
KPHQTOCEKÎPƀW[GGPWPÕPKEQUGPVKFQFGUFGGNEQPVTQNCFQT
hacia el equipo de iluminación, no generando el equipo ningún tipo feedback hacia el control. No permite un direccionamiento via software de los equipos, teniendo que realizarse
la creación de grupos de forma cableada. Este sistema se
RWGFGKPVGITCTGPUKUVGOCUFGEQPVTQNFGGFKſEKQU
The length of the control line wiring is limited by the voltage
drop that occurs along it, therefore, the maximum distance
is limited by the number of control gears connected to be
controlled. The latter establish the current per line and the
cable diameter used.
www.elt.es
4
La longitud del cableado de la línea de control está limitada por la caída de tensión que se produce a lo largo de la
misma, por tanto la máxima distancia está limitada por el núOGTQFGGSWKRQUCEQPVTQNCTEQPGEVCFQU'UVQUÕNVKOQUſLCP
la corriente por la línea y la sección del cable usado.
79
Regulation by means of touch control pushbutton
Regulación mediante pulsador touch control
Touch Control is a system that enables the simple and ecoPQOKETGIWNCVKQPQHNWOKPQWUƀWZ+VWUGUVJGOCKPUXQNVCIG
as a control signal, applying it by means of a normally open,
standard pushbutton on a control line, without any need for
URGEKſEEQPVTQNNGTU
Touch Control es un sistema mediante el cual se consigue
NCTGIWNCEKÎPFGNƀWLQNWOKPQUQFGWPCHQTOCUGPEKNNC[GEQnómica, que utiliza la tensión de red como señal de control,
aplicándola, a través de un pulsador estándar normalmente
abierto, en una línea de control, sin necesidad de controlaFQTGUGURGEÈſEQU
The Touch Control system enables you to carry out the basic functions of a regulation system by means of power-free
pushbutton. Depending on how long the button is pressed it
is possible to switch the light on or off or regulate it. Switching
the light on or off is done by short, sharp pressing or “click”. If
the button is pressed for a longer time it is possible to reguNCVGVJGNWOKPQWUƀWZDGVYGGPVJGOCZKOWOCPFOKPKOWO
levels alternately.
El sistema Touch Control permite realizar las funciones
básicas de un sistema de regulación mediante el accionamiento de un pulsador libre de potencia. Dependiendo de la
duración de la pulsación tiene lugar el encendido/apagado o
la regulación de la luz. El encendido/apagado del alumbrado
se consigue mediante una pulsación corta o “click” y medianVGWPCRWNUCEKÎPEQPVKPWCFCNCTGIWNCEKÎPFGNƀWLQNWOKPQUQ
entre el nivel máximo y el mínimo alternativamente.
TOUCH
L1
N
DA / LS
DA / N
Push
button
L
N
DA / LS
DA / N
L
N
DA / LS
DA / N
L
N
T
DLC ...-DALI
LED
MODULES
DLC ...-DALI
LED
MODULES
DLC ...-DALI
LED
MODULES
N L1
6JKU KU C WPKFKTGEVKQPCN KPVGTHCEG KG KPHQTOCVKQP ƀQYU KP
one direction. The equipment does not generate any type
of feedback. It does not allow for addressing by means of
equipment software. Groups have to be created by wiring.
This system cannot be integrated into building control systems.
Es un interfaz de regulación unidireccional, es decir la inHQTOCEKÎPƀW[GGPWPÕPKEQUGPVKFQPQIGPGTCPFQGNGSWKRQ
ningún tipo de feedback. No permite un direccionamiento vía
software de los equipos, teniendo que realizarse la creación
de grupos de forma cableada. Este sistema no se puede inVGITCTGPUKUVGOCUFGEQPVTQNFGGFKſEKQU
The length of the wiring and the number of equipment that
can be connected up are unlimited in theory, but in practice
at longer distances of over 25 metres, and with a bigger number of pieces of equipment connected, asynchronism may
occur during switching on and dimming at different points of
light simultaneously.
La longitud del cableado y el número de equipos que se
pueden conectar son, teóricamente, ilimitados, pero en la
práctica a mayores distancias, superiores a 25 metros, y mayor número de equipos conectados puede aparecer un asincronismo en el encendido y dimado simultaneo de diferentes
puntos de luz.
Owing to its characteristics, the use of this regulation
OGVJQFKUTGEQOOGPFGFHQTKPFKXKFWCNQHſEGUUOCNNOGGVKPI
rooms or bedrooms, landings and small spaces in general.
Debido a sus características, el uso de este método de
TGIWNCEKÎP GUV¶ KPFKECFQ RCTC QſEKPCU KPFKXKFWCNGU RGSWGñas salas de conferencias o habitaciones, rellanos y áreas
reducidas en general.
DALI Regulation
Regulación dali
As revealed by the meaning of this acronym, Digital AddresableLightingInterface, DALI is a digital and addressable
communication interface for lighting systems.
%QOQ KPFKEC GN UKIPKſECFQ FG GUVG CETÎPKOQ &KIKVCN #Fdresable Lighting Interface, DALI es un interfaz de comunicación digital y direccionable para sistemas de iluminación.
This is an international standard system in accordance with
IEC 62386, which ensures compatibility and interchangeability between different manufacturers’ equipment marked with
the following logo:
Este sistema es un estándar internacional, de acuerdo a la
norma IEC 62386, que asegura la compatibilidad e intercambiabilidad entre equipos de diferentes fabricantes, los cuales
están marcados con el siguiente logo:
DALI
L3
L2
L1
N
DA / LS
DA / N
L N PE DA DA
DAL I
DALI
controller
L
N
DA / LS
DA / N
L
N
DA / LS
DA / N
L
N
DA DA
DLC ...-DALI
LED
MODULES
DLC ...-DALI
LED
MODULES
DLC ...-DALI
LED
MODULES
N L1 L2 L3
80
www.elt.es
It is a bi-directional regulation interface with a master-slave
UVTWEVWTGYJGTGVJGKPHQTOCVKQPƀQYUHTQOCEQPVTQNNGTYJKEJ
operates as the master, to the control gears that only operate
as slaves, with the latter carrying out the orders or responding to the information requests received.
Es un interfaz de regulación bidireccional con una estrucVWTC OCGUVTQGUENCXQ FQPFG NC KPHQTOCEKÎP ƀW[G FGUFG WP
controlador, que opera como maestro, hacia los equipos de
iluminación que operan únicamente como esclavos, ejecutando los comandos o respondiendo a las solicitudes de información recibidas.
Digital signals are transmitted over a bus or two-wire control wire. These control wires can be negatively and positively
polarised, though the majority control gears are designed polarity free to make connection indifferent.
La comunicación mediante las señales digitales se realiza
a través de un bus o línea de control de dos hilos. Estos
hilos de control pueden poseer polaridad positiva y negativa,
aunque la mayoría de equipos están diseñados libres de polaridad para que la conexión sea indiferente.
No especially shielded cables are needed. It is possible to
wire the power line and DALI bus together with a standard
ſXGYKTGECDNG
No se necesitan cables especiales apantallados, pudiendo
realizarse el cableado conjunto de la línea de alimentación y
del bus DALI con una misma manguera estándar de 5 hilos.
DALI (DA)
DALI (DA)
e.g. NYM 5x...
Protective earth
Phase
Neutral conductor
Unlike other regulation systems, there is no need to create
wiring groups, thus all the pieces of equipment are connected in parallel to the bus, without bearing in mind the grouping
of these, simply avoiding a closed ring or loop topology.
A diferencia de otros sistemas de regulación, la creación
de grupos no se tiene que realizar de forma cableada, por
lo que todos los equipos se conectan en paralelo al bus sin
tener en cuenta la agrupación de los mismos, únicamente
evitando una topología en bucle o anillo cerrado.
Mechanical relays are not required to switch the lighting
on or off, given that this is done by means of orders sent
along the control line. Neither are bus termination resistors
required.
No se necesitan relés mecánicos para el encendido y apagado del alumbrado ya que se realiza mediante comandos
vía la línea de control. Tampoco se necesitan resistencias de
terminación del bus.
Consequently, the DALI interfaces offers wiring simplicity
KPCFFKVKQPVQITGCVƀGZKDKNKV[YJGPKVEQOGUVQFGUKIPKPIVJG
lighting installation.
Por tanto el interfaz DALI ofrece una simplicidad de caDNGCFQCUÈEQOQWPCITCPƀGZKDKNKFCFGPGNFKUGÌQFGNCKPUtalación del alumbrado.
DALI
operating device
DALI
operating device
DALI
controller
DALI
operating device
max 300m
DALI
operating device
DALI
operating device
DALI
operating device
DALI
operating device
DALI
operating device
DALI
operating device
www.elt.es
81
The maximum voltage drop along the control line must not
exceed 2V with the maximum bus current of 250mA. Therefore, the maximum wiring distance allowed depends on the
cable cross section, but it must never exceed 300m in any
case.
La máxima caída de tensión a lo largo de la línea de control no puede ser superior a 2V con la corriente máxima del
bus de 250mA. Por tanto, la máxima distancia de cableado
permitida depende de la sección del cable, pero en ningún
caso debe ser superior a 300m.
#HVGTYKTKPIUQHVYCTGKUWUGFVQEQPſIWTGVJG&#.+NKIJVing system. Up to 16 different scenarios can be created, addressing the equipment individually up to a maximum of 64
addresses, by groups up to a maximum of 16, or simultaneQWUN[D[OGCPUQHCőDTQCFECUVŒQTFGT6JGEQPſIWTCVKQPECP
be changed at any time without any need for re-wiring.
7PCXG\TGCNK\CFQGNECDNGCFQUGTGCNK\CNCEQPſIWTCEKÎP
del sistema de iluminación DALI vía software. Se pueden
crear hasta 16 escenas diferentes, direccionando los equipos de forma individual hasta un máximo de 64 direcciones,
por grupos hasta un máximo de 16, o de forma simultanea
OGFKCPVGWPEQOCPFQőDTQCFECUVŒ.CEQPſIWTCEKÎPRWGFG
ser cambiada en cualquier momento sin necesidad de recablear.
The DALI system has a logarithmic regulation curve adLWUVGFVQJWOCPG[GUGPUKVKXKV[FGſPGFKPVJGKPVGTPCVKQPCN
standard, IEC 62386. The possible regulation range is set
at from 0.1% to 100%. The minimum is determined by the
equipment manufacturer.
%
Luminous
Flux
El sistema DALI posee una curva de regulación logarítOKECCLWUVCFCCNCUGPUKDKNKFCFFGNQLQJWOCPQFGſPKFCGP
la norma internacional IEC 62386. El rango de regulación
posible está establecido entre el 0.1% y el 100%, estando
determinado el nivel mínimo por el fabricante del equipo.
100
90
80
70
60
50
40
30
20
10
0
0
50
100
150
200
250
Digital Light Value
The time needed to go from one light level to another,
known as the ‘fade time’ and the speed of the change, the
‘fade rate’ can be set by the software.
El tiempo necesario para ir desde un nivel lumínico a
otro, denominado “fade time”, y la velocidad del cambio de
NCNW\ŒHCFGTCVGŒVCODKÃPUQPRCT¶OGVTQUEQPſIWTCDNGUXÈC
software.
The DALI system lies in the fringe between the complex
and costly but powerful ones; control systems for buildings
that offer total functionality and the most simple and economic regulation systems, such as, for example, the 1-10V one.
El sistema DALI se encuentra situado en la franja comprendida entre los complejos y costosos, pero potentes, sisVGOCUFGEQPVTQNFGGFKſEKQUSWGQHTGEGPWPCHWPEKQPCNKFCF
total y los sistemas de regulación más económicos y sencillos como puede ser el 1-10V.
Functions
e.g.: EIB /
LON
DALI
Costs
1...10V
This interface can be used in simple applications, independently, to control a luminaire or a small room and in high level
applications such as being integrated by means of gateways
into building smart control systems.
Este interfaz puede utilizarse en aplicaciones sencillas,
cómo puede ser el control de una luminaria o una pequeña
sala de forma independiente, y en aplicaciones de alto nivel,
integrándose mediante pasarelas en sistemas de control inVGNKIGPVGFGGFKſEKQU
82
www.elt.es
5.4.2.- Control system components.
5.4.2.-Componentes del sistema de control.
Apart from the light source to be controlled, lighting management systems are made up of other additional components. Among these you have control gears, switches and
command wire equipments, sensors, controllers, adaptors,
TGRGCVGTUEQPXGTVGTUICVGYC[UCPFEQPſIWTCVKQPCPFOQPKtoring tools.
Además de la fuente de luz que se pretende controlar, los
sistemas de gestión del alumbrado están compuestos por
otros componentes adicionales. Entre estos componentes
se encuentran los equipos, accionamientos o elementos de
mando, sensores, controladores, adaptadores, repetidores,
EQPXGTVKFQTGURCUCTGNCU[NCUJGTTCOKGPVCUFGEQPſIWTCEKÎP
y de monitorización.
Control gears:
Equipos:
Lighting control gears, drivers for LED modules, ballasts
HQT ƀWQTGUEGPV CPF FKUEJCTIG NCORU VTCPUHQTOGTU HQT JCNQgen lamps are the components commissioned with making
the light sources work properly. They must be adjustable by
the control method chosen to enable their integration into a
lighting management system.
Los equipos de iluminación, drivers para módulos LED,
DCNCUVQU RCTC N¶ORCTCU FG ƀWQTGUEGPEKC [ FG FGUECTIC
transformadores para lámparas halógenas, son los componentes encargados de hacer funcionar las fuentes de luz de
forma correcta. Éstos, para poder integrarse en un sistema
de gestión de alumbrado, deben ser regulables por el método de control elegido.
Switches or control elements:
Accionamientos o elementos de mando:
These are components by means of which the user interacts with the lighting management system, making it possible
to switch the light on and off and regulate it directly by hand.
This group consists of pushbuttons, knobs and control panels.
Son los componentes mediante los que el usuario interacciona con el sistema de gestión del alumbrado, permitiendo
encender, apagar o regular la luz voluntariamente de forma
manual y directa. En este grupo se encuentran los pulsadores, los mandos rotativos y paneles de control.
Sensors and detectors:
Los sensores o detectores:
These are devices capable of detecting physical and
chemical magnitudes and transforming them into signals that
can be processed. In lighting management systems, presence detectors and photocells are particularly important as
they serve to switch on and off and regulate the lighting automatically, depending on the presence of persons and the
natural level of light in the space to be illuminated.
Son dispositivos capaces de detectar magnitudes físicas
o químicas y transformarlas en señales que pueden ser procesadas. En los sistemas de gestión de alumbrado destacan
los detectores de presencia y las fotocélulas, mediante los
cuales el encendido, apagado o regulación de la luz se realiza de forma automática dependiendo de la presencia de
personas y el nivel de luz natural en la estancia.
Control units and controllers:
Unidades de control o controladores:
These components serve to receive all the information
from the rest of the system’s components, process it and
generate the control orders to be distributed intelligently.
Son los componentes encargados de recibir toda la información procedente del resto de componentes del sistema,
procesarla y generar los comandos de control para distribuirlos de forma inteligente.
Repeaters:
Repetidores:
These are components that amplify the level or power of
weak signals, thus, in lighting management systems, they
must be used when longer wiring distances are required, or
a greater number of equipment needs to be connected than
is allowed in principle.
5QPEQORQPGPVGUSWGCORNKſECPGNPKXGNQNCRQVGPEKCFG
las señales débiles, por lo que, en los sistemas de gestión de
alumbrado, se deben utilizar cuando se necesitan mayores
distancias de cableado o mayor número de equipos conectados de lo permitido.
Adapters, converters and gateways:
Adaptadores, convertidores y pasarelas:
These components are needed when you have to connect
components that do not use the same communication protocol. They serve to convert a signal into another in order to
enable communication between the different devices. They
range from simple adapters that convert an electrical signal
to communicate between a few components to gateways that
enable communication between systems with different protocols and architectures at all levels of communication.
Estos componentes son necesarios cuando se quieren
conectar entre sí componentes que no utilizan el mismo protocolo de comunicación. Su misión es convertir una señal en
otra para permitir la comunicación entre diferentes dispositivos. Existen desde simples adaptadores que convierten una
señal eléctrica para comunicar unos pocos componentes,
hasta pasarelas que permiten comunicar entre sí sistemas
con protocolos y arquitecturas diferentes a todos los niveles
de comunicación.
%QPſIWTCVKQPCPFOQPKVQTKPIVQQNU
*GTTCOKGPVCUFGEQPſIWTCEKÎP[FGOQPKVQTK\CEKÎP
More advanced lighting management systems need software tools to enable their addressing, programming, parameterising and monitoring.
Para los sistemas de gestión del alumbrado más avanzados, son necesarias herramientas software que permitan el
direccionamiento, la programación, la parametrización y la
monitorización de los mismos.
www.elt.es
83
A solution for every application
Una solución para cada aplicación
Lighting management systems can be more or less complex depending on the solution chosen for each one; the control method chosen, the number and type of components,
the interconnection between them and their integration with
buildings’ control systems.
Las instalaciones de gestión del alumbrado tendrán una
menor o mayor complejidad dependiendo de la solución escogida para cada una de ellas; del método de control elegido, el número y tipo de componentes, la interconexión entre
GNNQU[NCKPVGITCEKÎPEQPUKUVGOCUFGEQPVTQNFGGFKſEKQU
There are a wide range of possibilities ranging from the
UKORNGUV UQNWVKQPU EQPUKUVKPI QH KPFKXKFWCN NWOKPCKTGU ſVVGF
with adjustable equipment and photocells connected directly
between them, which regulate the light separately from the
rest of the lighting, to more advanced lighting management
systems, integrated into the smart control of buildings, which
can control luminaires in different rooms and on different
ƀQQTUYKVJOWNVKRNGWUGUVQVJGGZVGPVQHDGKPICDNGVQETGCVG
different atmospheres adapted to each situation and to report
information on their status at all times.
Existen una gran variedad de posibilidades, desde las soluciones más sencillas compuestas por luminarias individuales, dotadas de equipos regulables y fotocélulas conectados
directamente entre ellos, que regulan la luz independientemente del resto del alumbrado, hasta los sistemas de gestión del alumbrado más avanzados, integrados en el control
KPVGNKIGPVGFGGFKſEKQUSWGEQPVTQNCPNWOKPCTKCUGPFKHGTGPtes salas y en diferentes plantas con múltiples usos, pudiendo crear diferentes ambientes adaptados a cada situación y
reportar información de su estado en cada momento.
6.- SELECTING LED TECHNOLOGY
6.- ELECCIÓN TECNOLOGIA LED
5VGRUVQDGVCMGP
Comments
Pasos a seguir
1.- Decide on the application
Observaciones
Indoor
Outdoor
Degrees of environmental protection
1.- Decidir aplicación
Indoor
Outdoor
Grados de protección ambiental
2.- Decide on the most suitable LED module.
Lumens, dimensions, CV or CC technology, photometry, etc.
2.- Decidir el módulo LED más adecuado.
Lúmenes, dimensiones, tecnología CV ó CC, fotometría…
3.- Decide on a CV or CC control gear
CV: Output voltage of 12Vcc or 24Vcc
Installed power
CC: Output current, there are numerous versions ranging from 0.2A to 2.5A.
Module or LED module system voltage must be between the minimum and maximum of the power supply
3.- Decidir la fuente de alimentación CV ó CC CV: Tensión de salida 12 ó 24Vcc
La potencia instalada
CC: Intensidad de salida, existen multitud de versiones, desde 0,2A hasta 2,5A.
La tensión del módulo o sistema de módulos LEDs debe estar comprendida entre la mínima y máxima de la fuente de
alimentación
4.- Choose the regulation technology
4.- Elegir tecnología de regulación
~ Control gears
~ Switches or control elements
~ Sensors and detectors:
~ Control units and controllers
~ Repeaters:
~ Adapters, converters and gateways
`%QPſIWTCVKQPCPFOQPKVQTKPIVQQNU
~ Equipos
~ Accionamientos o elementos de mando
~ Los sensores o detectores
~ Unidades de control o controladores
~ Repetidores
~ Adaptadores, convertidores y pasarelas
`*GTTCOKGPVCUFGEQPſIWTCEKÎP[FGOQPKVQTK\CEKÎP
84
www.elt.es
8.- MARKS AND INDICATIONS
7.- MARCAS E INDICACIONES
CE: Mark that declares product conformity with the
applicable European directives.
Marca que declara la conformidad del producto con
las directivas europeas que le apliquen a su área.
'0'% %GTVKſECVKQP OCTMKPI ITCPVGF D[ CP QHſEKCN
body that accredits compliance with the applicable
international standards. Quite often the product is
'0'% EGTVKſCDNG DWV JCU PQV WPFGTIQPG VJG QHſEKCN
tests. Contact the Technical Department for further
information.
01
CTECFGEGTVKſECEKÎPQVQTICFCRQTWPQTICPKUOQQſ/
cial que acredita el cumplimiento de las normas internacionales que aplican a su área. A menudo, el proFWEVQGUEGTVKſECDNG'0'%RGTQPQJCUKFQUQOGVKFQ
CNQUGPUC[QUQſEKCNGU2CTCO¶UKPHQTOCEKÎPRWGFG
contactar con el Dpto. Técnico.
CLASS II: Device protected against electric discharges by basic isolation and other supplementary or reKPHQTEGF KUQNCVKQP +V OC[ DG ſVVGF YKVJ C HWPEVKQPCN
grounding connection.
CLASE II: Dispositivo protegido contra descargas
eléctricas por un aislamiento básico y otro suplementario o reforzado. Puede incorporar una conexión funcional a tierra.
CONTROL GEAR: An independent auxiliary device
VJCVECPDGſVVGFUGRCTCVGN[QWVUKFGVJGNWOKPCKTGCPF
without any additional housing.
EQUIPO INDEPENDIENTE: Aparato auxiliar independiente que puede montarse separadamente en el
exterior de una luminaria y sin envolvente adicional.
Safety Extra Low Voltage (SELV): Low voltage safety
device. This refers to equipment that does not exceed
50V at the output or 120V in the case of its ripple being less than 10% of its nominal value, in addition to
other requirements. Contact our Technical Department for further information.
SELV
SELV: Dispositivo de baja tensión de seguridad. Se
TGſGTGCNQUGSWKRQUSWGPQUWRGTGPNQU8CNCUClida o que no superen los 120V en caso de que su
rizado sea menor al 10% de su valor nominal, además de otros requisitos. Para más información puede
contactar con nuestro Dpto. Técnico.
Device which incorporates thermal protection with automatic resetting.
Dispositivo que incorpora protección térmica con
rearme automático.
Safety transformer resistant to short-circuits.
Transformador de seguridad resistente a cortocircuitos.
#FGXKEGVJCVECPDGſVVGFKPHWTPKVWTGOCFGQHOCVGrials about which nothing is known as regards their
ƀCOOCDKNKV[ EJCTCEVGTKUVKEU %QORNKGU YKVJ VJG VGOperature requirements of Part 14 of the standard,
VDE 0710.
M
Device protected against over temperature. The number indicated inside the triangle indicates the maximum temperature at any point on the enclosure surface in the event of equipment failure.
M
Dispositivo que puede montarse en muebles de cuyos materiales no se conocen sus características de
KPƀCOCDKNKFCF%WORNGEQPNQUTGSWKUKVQUFGVGORGTCtura de la norma VDE 0710 Parte 14.
Dispositivo protegido contra sobre-temperatura. El
número indicado en el interior del triángulo indica la
VGORGTCVWTCO¶ZKOCGPEWCNSWKGTRWPVQFGNCUWRGTſcie de la envolvente en caso de fallo del equipo.
Regulation with a cutting device at the beginning or
the end of the phase.
LC
GIWNCEKÎPEQPFKURQUKVKXQFGEQTVGCNKPKEKQQCNſPCN
4
de fase.
Regulation with a cutting device at the beginning of
the phase (Leading-edge dimming).
L
Regulación con dispositivo de corte al inicio de fase
(Leading-edge dimming).
Regulation with a cutting device at the end of the
phases (Trailing-edge dimming).
C
GIWNCEKÎP EQP FKURQUKVKXQ FG EQTVG CN ſPCN FG HCUG
4
(Trailing-edgedimming).
Earth connection for protection against electrical discharges for Class I devices.
Borne de conexión de tierra de protección contra descargas eléctricas para dispositivos clase I.
Earth connection except exclusively functional or security connection.
Borne de conexión a tierra en caso de que ésta no
sea exclusivamente funcional o de seguridad.
www.elt.es
85
Functional earth connection. Connection which unites
all parts which have to, out of necessity, be connected
to the earth due to different safety reasons.
Borne de conexión de tierra funcional. Borne al que
se unen las partes que necesariamente deben de
conectarse a tierra por razones diferentes de las de
seguridad.
Power factor: indicator of the gap between a control
gear current and voltage whenever the current is sinusoidal. As the power factor decreases, the equipment’s current demand increases, needing bigger
cable cross section at the input. A high power factor is
considered that which is equal to or above 0,96.
Factor de potencia: indicador del desfase entre la
tensión y la corriente de alimentación de un equipo
siempre que la corriente sea senoidal. A medida que
el factor de potencia disminuye, la demanda de corriente de un equipo es mayor, precisando secciones
de hilo en la entrada cada vez mayores. Un factor de
potencia alto es considerado aquél que es igual o mayor que 0,96
'HſEKGPE[ KU VJG TGNCVKQPUJKR VJCV KU GUVCDNKUJGF DGtween the output delivered by the system (energy, luminous, etc.) and the total power consumed from the
RQYGTUWRRN[TGƀGEVKPIVJGU[UVGOŏUNQUUGU+VECPDG
GZRTGUUGFKPYJGTGVJGOQTGGHſEKGPVCU[UVGOKU
the closer it gets to 100%.
Rendimiento: es la relación que se establece entre la
potencia útil que entrega el sistema (energética, lumínica, etc) y la potencia total que consume del sumiPKUVTQGPGTIÃVKEQTGƀGLCPFQNCURÃTFKFCUSWGVKGPGGN
sistema. Puede expresarse en %, siendo el sistema
O¶UGſEKGPVGEWCPVQO¶UUGCEGTSWGC
Maximum junction temperature: This is the maximum
operating temperature of an LED at semiconductor
level. Therefore, it is very important to have a good
heat design to keep the Tj as low as possible, which
will in turn prolong the service life of the LED.
Tj
Temperatura máxima de la unión: Se trata de la temperatura máxima de funcionamiento de un LED a nivel del semiconductor. Por lo tanto, es muy importanVGVGPGTWPDWGPFKUGÌQVÃTOKEQRCTCOCPVGPGTNC6L
NQO¶UDCLCRQUKDNGNQEWCNCNCTICT¶NCXKFCFGN.'&
Ta: Maximum environment temperature allowed in
the space where the control gear is located that must
be respected for proper operation.
Ta
Ta:Temperatura ambiente máxima permitida en el habitáculo de la fuente de alimentación que debe respetarse para un correcto funcionamiento.
Tc: Maximum temperature allowed at the measuring
point indicated on the casing to ensure proper equipment operation.
Tc
Tc: Máxima temperatura admisible en el punto de
medida indicado en la envolvente para asegurar un
correcto funcionamiento del equipo.
The THD or total harmonic distortion factor is an indicator of how important harmonics are in our control
gear, always referring to drivers and always to current
JCTOQPKEU +V KU KPFKECVGF D[ VJG NQYGT VJG XCNWG
the better.
THD
El THD o factor de distorsión armónica es un indiECFQT FG NQ UKIPKſECVKXQU SWG UQP NQU CTOÎPKEQU GP
PWGUVTQGSWKRQTGſTKÃPFQUGUKGORTGGPFTKXGTUUKGOpre a armónicos de corriente. Viene indicado en %,
UKGPFQOGLQTEWCPVQO¶UTGFWEKFQUGCGNXCNQT
86
www.elt.es
ACCESSORIES INDEX
ÍNDICE ACCESORIOS
ITP - Input transient and surges protection
ITP - Equipos auxiliares de protección contra sobretensiones de red
y rayos ...................................................................... 90
eDIM - Universal pushbutton dimmers
eDIM - Reguladores universales por pulsado .......... 91
www.elt.es
89
ITP
100-277V
50-60Hz
+PRWVVTCPUKGPVCPFUWTIGURTQVGEVKQP
Equipos auxiliares de protección contra sobretensiones de red
y rayos
31
68
55
29
9
M8
Before reaching the breakdown voltage of the luminaire system with
respect to ground, ITP device product a discharge through selfprotection system that brings the energy that could be dangerous to
ground.
Input Voltage
Model
Modelo
ITP 277V-8KA
Antes de llegar a la tensión de ruptura del sistema de la luminaria con
respecto a tierra, los equipos ITP producen una descarga a través del
propio sistema de protección que traslada la energía que pudiese ser
peligrosa de una manera segura a tierra.
0QOKPCN
Surge Current
/CZKOWO
Surge Current
Tensión de
circuito abierto
Corriente
nominal de
transitorio
Corriente
máxima de
transitorio
1RGP%KTEWKV
Voltage
2TQVGEVKQP
Level L-N
"M#
2TQVGEVKQP
Level LN-PE
"M#
Ref. No.
Rango de
tensión de
entrada
V
V
kA
kA
kV
kV
3512001
100-277V
10kV
3
8
1,6
2,5
Nivel de
protección L-N
@3kA
7PKVU
RGTDQZ
Nivel de
Unidades
protección LN-T
por caja
@3kA
30
~ Suitable for Class I and Class II luminaires.
~ Device suitable for HID, FLUO and LED outdoor applications with
IP67 protection.
~ Low Stand-by power consumption 0,05W MAX.
~ Type 3 Protection equipment considering IEC 61643-11/2007.
~ Withstands [email protected] (common/differential) (90/90)**.
~ Withstands [email protected] (common/differential) (40/50)**.
~ Withstands [email protected] (common/differential) (20/15)**.
~ 50/60 Hz frequencies allowed.
~ Apto para montajes en luminarias de tipo Clase I o Clase II.
~ Apto para aplicaciones HID, FLUO y LED de exterior con protección
IP67.
~ Pérdidas reducidas 0,05W máximo.
~ Equipos de protección tipo 3 según norma IEC 61643-11/2007.
~ Soporta [email protected] (común/diferencial) (90/90)**.
~ Soporta [email protected] (común/diferencial) (40/50)**.
~ Soporta [email protected] (común/diferencial) (20/15)**.
~ 50/60 Hz permitido.
** Surges every 50 seconds.
** Pulsos cada 50 segundos.
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
More detailed information is available on www.elt.es\productos\pdf\702000000_i.pdf
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
Más información detallada en www.elt.es\productos\pdf\702000000_e.pdf
N
L
LN
ITP
90
L
N
POWER SUPPLY
www.elt.es
Universal pushbutton dimmers for DLC-B and DLC-A ranges
Reguladores universales por pulsador para las gamas DLC-B y DLC-A
230V halogen
230V LED
low energy
lamp
LED driver
electronic
transformer
Ø 54
4,4
22,2
50,6
Power range
Maximum current
Voltage
Weight
Ref. No.
Rango de potencia
Corriente máxima
Tensión
Peso
W
A
V ± 10%
Kg
eDIM 100
9954001
1… 100
0,43
230
0,035
eDIM 440
9954002
1… 440
1,91
230
0,038
Model
Modelo
~ IP20 equipment.
~ Class II.
~ Dimming range: 5-100% (min. 1W).
~ Adjustable minimum dimming level.
~ With softstart.
~ Capable of memorizing most recent light level.
~ Overload protection.
~ Short circuit protection.
~ Overheating protection.
~ Built-in mounting box or wall mounting.
~ Used for dimmable LEDs, CFLs and CCFLs.
~ Used for 230V halogen lamps
~ Used for dimmable LED drivers.
~ Used for low voltage halogen lamps over electronic transformers for
trailing-edge control.
~ Used for incandescent lamps.
~ Several eDIM 100 or eDIM 440 can not be controlled by the same
push-button.
~ Push button with signal lamp must not be used.
~ Equipos IP20.
~ Clase II.
~ Rango de regulación: 5-100% (mín. 1W).
~ Nivel de regulación mínimo ajustable.
~ Con arranque suave.
~ Capaz de memorizar el nivel de luz más reciente.
~ Protección contra sobrecargas.
~ Protección contra cortocircuitos.
~ Protección contra calentamientos.
~ Para incorporar en caja de empotrar estándar.
~ Válido para LEDs dimables, CFLs y CCFLs.
~ Válido para lámparas halógenas de 230V.
~ Válido para drivers de LED dimables.
~ Válido para lámparas halógenas de baja tensión sobre los
VTCPUHQTOCFQTGUGNÃEVTKEQURCTCNCTGIWNCEKÎPCNſPCNFGNCHCUG
~ Válido para lámparas incandescentes.
~ Varios eDIM 100 o eDIM 440 no pueden ser controlados por el
mismo pulsador.
~ No apto para pulsadores con luminoso.
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
S
N
L
N
EN-60669 Switches / Interruptores
www.elt.es
L
91
230 VAC
eDIM
230V
50-60Hz
FLUORESCENT INDEX
ÍNDICE FLUORESCENCIA
'NGEVTQPKE572'45.+/DCNNCUVUHQTQTƀWQTGUEGPV
lamps T5-HE and T5-HO
Balastos electrónicos SUPER SLIM para 1 o 2 lámparas
ƀWQTGUEGPVGU6*'[6*1 ................................ 107
ELECTRONIC BALLASTS
BALASTOS ELECTRÓNICOS
Electronic ballasts for 1 or 2 compact lamps
Balastos electrónicos para 1 o 2
lámparas compactas ................................................ 96
'NGEVTQPKE572'45.+/DCNNCUVUHQTQTƀWQTGUEGPV
lamps T5-HE and T5-HO Universal Voltage 110-240V
Balastos electrónicos SUPER SLIM para 1 ó 2 lámparas
ƀWQTGUEGPVGU6*'[6*1VGPUKÎPWPKXGTUCN
110-240V ................................................................ 108
Electronic ballasts for compact lamps. 1-2 lamps
Protection class II and independent use. IP20
Balastos electrónicos para 1 o 2 lámparas compactas
con cubre-bornas.
Clase II y uso “Independiente”. IP20 ........................ 97
'NGEVTQPKEDCNNCUVUHQTQTƀWQTGUEGPVNCORU
T5-HE 14W
$CNCUVQUGNGEVTÎPKEQURCTCQN¶ORCTCUƀWQTGUEGPVGU
de 14W T5-HE ....................................................... 109
Electronic ballasts for 1 or 2 compact lamps.
Universal Voltage 110-240V
$CNCUVQUGNGEVTÎPKEQURCTCQN¶ORCTCUƀWQTGUEGPVGU
compactas. Tensión universal 110-240V ................. 98
'NGEVTQPKEDCNNCUVUHQTQTƀWQTGUEGPVNCORU6*'
14W. Universal voltage 110-240V
$CNCUVQUGNGEVTÎPKEQURCTCÎN¶ORCTCUƀWQTGUEGPVGU
de 14W T5-HE. Tensión universal 110-240V ......... 110
Electronic ballasts for 1 or 2 compact lamps. Protection
Class II and independent use. IP20. Universal Voltage
110-240V
$CNCUVQUGNGEVTÎPKEQURCTCQN¶ORCTCUƀWQTGUEGPVGU
compactas con cubre-bornas. Clase II y uso independiente. IP20. Tensión universal 110-240V ................ 99
'NGEVTQPKEDCNNCUVUHQT6*1ƀWQTGUEGPVNCORU
$CNCUVQUGNGEVTÎPKEQURCTCN¶ORCTCUƀWQTGUEGPVGU
T5-HO ...................................................................... 111
'NGEVTQPKEDCNNCUVUHQTQTƀWQTGUEGPVNCORU
T8 / TC-L / T5 MULTIPOWER TECHNOLOGY
$CNCUVQUGNGEVTÎPKEQURCTCQN¶ORCTCUƀWQTGUEGPVGU
T8 / TC-L / T5 TECNOLOGÍA MULTIPOTENCIA .. 100
'NGEVTQPKEDCNNCUVUHQTQTƀWQTGUEGPVNCORU
T5-HO 24W
$CNCUVQUGNGEVTÎPKEQURCTCQN¶ORCTCUƀWQTGUEGPVGU
de 24W T5-HO ....................................................... 112
'NGEVTQPKEDCNNCUVUHQTQTƀWQTGUEGPVNCORU6
Balastos electrónicos para 1 o 2 lámparas
ƀWQTGUEGPVGU6 ..................................................... 101
Electronic ballasts for 2 T5-HO – UV – Disinfection
CRRNKECVKQPUHQTƀWQTGUEGPVNCORU
$CNCUVQUGNGEVTÎPKEQURCTCN¶ORCTCUƀWQTGUEGPVGU
T5-HO – UVA – Aplicaciones de desinfección ....... 113
'NGEVTQPKEDCNNCUVUHQTƀWQTGUEGPVNCOR6
Universal voltage 110-240V
$CNCUVQUGNGEVTÎPKEQURCTCN¶ORCTCƀWQTGUEGPVG6
Tensión universal 110-240V .................................. 102
'NGEVTQPKEDCNNCUVUHQTQTƀWQTGUEGPVNCORU6
reduced length
$CNCUVQUGNGEVTÎPKEQURCTCQN¶ORCTCUƀWQTGUEGPVGU
T5 longitud reducida ............................................... 114
'NGEVTQPKEDCNNCUVUHQTQTƀWQTGUEGPVNCORU6
Universal voltage 110-240V
Balastos electrónicos para 1, 2, 3 o 4 lámparas
ƀWQTGUEGPVGU66GPUKÎPWPKXGTUCN8 ...... 103
Dimmable electronic ballasts for 1 or 2 T8 / TC-L / T5
ƀWQTGUEGPVNCORU84')7.#6+10
Balastos electrónicos dimables para 1 o 2 lámparas
ƀWQTGUEGPVGU66%.6
REGULACIÓN 1... 10V .......................................... 115
'NGEVTQPKEDCNNCUVUHQTQTƀWQTGUEGPVNCORU6QT6
Universal voltage 110-277V
$CNCUVQUGNGEVTÎPKEQURCTCQN¶ORCTCUƀWQTGUEGPVGU
T8 o T5. Tensión universal 110-277V .................... 104
&#.+FKOOCDNGGNGEVTQPKEDCNNCUVUHQTƀWQTGUEGPV
lamp T8 / T5 / TC-L
Balastos electrónicos dimables DALI para 1 lámpara
ƀWQTGUEGPVGU666%. ................................... 116
'NGEVTQPKEDCNNCUVUHQTQTƀWQTGUEGPVNCORU
T8 / TC-L 18W
$CNCUVQUGNGEVTÎPKEQURCTCQN¶ORCTCUƀWQTGUEGPVGU
de 18w T8 / TC-L ................................................... 105
&#.+FKOOCDNGGNGEVTQPKEDCNNCUVUHQTƀWQTGUEGPV
lamps T8 / T5 / TC-L
Balastos electrónicos dimables DALI para 2
N¶ORCTCUƀWQTGUEGPVGU666%. ................... 117
'NGEVTQPKEDCNNCUVUQTƀWQTGUEGPVNCORU66%.
T5. MULTIPOWER TECHNOLOGY
$CNCUVQUGNGEVTÎPKEQURCTCQN¶ORCTCUƀWQTGUEGPVGU
T8 / TC-L / T5.
TECNOLOGÍA MULTIPOTENCIA .......................... 106
94
www.elt.es
DALI dimmable electronic ballasts for 3 or 4
ƀWQTGUEGPVNCORU666%.
Balastos electrónicos dimables DALI para 3 o 4
N¶ORCTCUƀWQTGUEGPVGU666%. ................... 118
DALI dimmable electronic ballasts for 1 or 2
6%6'6%&'6%.ƀWQTGUEGPVNCORU
Balastos electrónicos dimables DALI para 1 o 2
lámparas compactas TC-TE / TC-DE / TC-L .......... 119
Emergency lighting modules with self-diagnosis function
HQTVQ9ƀWQTGUEGPVNCORU
Módulos para alumbrado de emergencia, con
CWVQFKCIPÎUVKEQRCTCN¶ORCTCUƀWQTGUEGPVGU
de 6 a 80W ............................................................. 139
Emergency lighting modules with self-diagnosis function
HQTVQ9ƀWQTGUEGPVNCORU
Módulos para alumbrado de emergencia, con autodiagPÎUVKEQRCTCN¶ORCTCUƀWQTGUEGPVGU
de 6 a 80W ............................................................. 140
DALI electronic ballast: characteristics and technical
information
Características de balastos electrónicos DALI
e información técnica .............................................. 120
TECHNICAL INFORMATION FOR FLUORESCENCE
INFORMACIÓN TÉCNICA SOBRE FLUORESCENCIA
Capacities for power factor correction. Fluorescent lamps
Capacidades para corregir el factor de potencia.
.¶ORCTCUƀWQTGUEGPVGU ......................................... 141
'NGEVTQPKEDCNNCUVUHQTQTƀWQTGUEGPVNCORU6
IP67 protection
$CNCUVQUGNGEVTÎPKEQURCTCQN¶ORCTCUƀWQTGUEGPVGU
T8 proteccion IP67 ................................................. 122
Table of compact lamps
Tabla de lámparas compactas .............................. 142
ELECTRONIC BALLASTS
BALASTOS ELECTRÓNICOS
Fluorescent lamps
.¶ORCTCUƀWQTGUEGPVGU ......................................... 143
&%'NGEVTQPKEDCNNCUVUHQTQTƀWQTGUEGPVNCORU
$CNCUVQUGNGEVTÎPKEQURCTCQN¶ORCTCUƀWQTGUEGPVGU
alimentados en corriente continua .......................... 123
Electromagnetic ballats
Balastos electromagnéticos .................................... 143
Combinations between ELT electronic ballasts and
ƀWQTGUEGPVNCORU
Combinaciones de balastos electrónicos ELT con
N¶ORCTCUƀWQTGUEGPVGU .......................................... 124
Marks and indications
Marcas e indicaciones ............................................ 145
Manufacturing standards
Normas de fabricación ............................................ 146
%QODKPCVKQPUGNGEVTQPKEDCNNCUVUƀWQTGUEGPVNCORU
Combinaciones balastos electrónicos-lámparas
ƀWQTGUEGPVGU .......................................................... 128
'PGTI[GHſEKGPE[TGSWKTGOGPVUHQTDCNNCUVU
HQTƀWQTGUEGPVNKIJVKPI
4GSWKUKVQUFGGſEKGPEKCGPGTIÃVKECFGNQUEQORQPGPVGU
RCTCN¶ORCTCUƀWQTGUEGPVGU .................................. 149
MAGNETIC BALLASTS
REACTANCIAS ELECTROMAGNETICAS
6CDNGQHDCNNCUVUNCORUEKTEWKVENCUUKſECVKQP
6CDNCRCTCNCENCUKſECEKÎPFGN
conjunto balasto-lámpara ....................................... 150
Ballasts for compact lamps
Reactancias para lámparas compactas ................ 129
$CNNCUVUHQTVWDWNCTƀWQTGUEGPVNCORU
4GCEVCPEKCURCTCN¶ORCTCUƀWQTGUEGPVGU
tubulares ................................................................. 133
Electronic ballasts
Balastros electrónicos ............................................ 152
Guides for the desing of high frequency luminaires
Guías para el diseño de luminarias
en alta frecuencia ................................................... 158
'NGEVTQPKEUVCTVGTUHQTƀWQTGUEGPVNCORU
Cebadores electrónicos para
N¶ORCTCUƀWQTGUEGPVGU ......................................... 137
EMERGENCY LIGHTING MODULES
MÓDULOS PARA ALUMBRADO DE EMERGENCIA
Instructions for the installation of
GNGEVTQPKEDCNNCUVUHQTƀWQTGUEGPVNCORU
Instrucciones para la instalación de balastos electrónicos
RCTCN¶ORCTCUƀWQTGUEGPVGU .................................. 163
Emergency lighting modules with self-diagnosis function
HQTVQ9ƀWQTGUEGPVNCORU
Módulos para alumbrado de emergencia, con
CWVQFKCIPÎUVKEQRCTCN¶ORCTCUƀWQTGUEGPVGU
de 6 a 80W ............................................................. 138
Maximum number of equipments for each switch
Número de balastos por interruptor automático y
diferencial .............................................................. 165
Manufacturing standards
Normas de fabricación ............................................ 166
www.elt.es
95
BE-TC-5
220-240V
DC/AC 50-60Hz
Electronic ballasts for 1 or 2 compact lamps
Balastos electrónicos para 1 o 2 lámparas compactas
29,5
Ø 4,2
69 63
92,5
108
Model
Modelo
Ref. No.
9621180
BE 218-TC-5
9621181
BE 226-TC-5
BE 242-TC-5
9621182
9621183
TC-DE
TC-TE
2x
1x
13
13
TC-SE
2x
1x
7, 9, 11
7, 9, 11
TC-DD
1x
16
TC-DE
TC-TE
2x
1x
18
18
TC-DE
TC-TE
2x
1x
26
26, 32, 42
TC-L
TC-F
2x
1x
18, 24
18, 24, 36, 40
T5C
2x
1x
22
22, 40
TC-DE
TC-TE
2x
26, 32, 42
1x 26, 32, 42, 57, 70
TC-L
TC-F
2x
1x
18, 24, 36
18, 24, 36,40
T5C
2x
1x
22
22, 40
1RGTCVKPI
temp.
7PKVU
RGTDQZ
Index
Approvals
Temp.máx.
envolvente
(A)
NJ
tc (°C)
0,04… 0,13
0,97
75
-20... +50
30
A2
01
0,09… 0,17
0,97
75
-20... +50
30
A2
01
0,08… 0,23
0,97
75
-20... +50
30
A2
01
0,09... 0,415
0,97
75
-20... +50
30
A2
01
Intensidad
Potencia
Max.temp.
CVVERQKPV
Factor
de
potencia
W
BE 213-TC-5
Power
factor
Current
Power
Temp.
Índice
funcionamiento Unidades
por caja
ta (°C)
EEI
Homologaciones
~ Ballast for built in use (1).
~ Cathode preheating start for a long life of lamp. Flicker free.
`%QPUVCPVRQYGTKPNCORCPFUVCDKNKUGFNWOKPQWUƀWZ
~ High frequency operation. High energy effciency.
~ Without stroboscopic effect.
~ Permitted input voltage: AC/DC 198-264V.
~ Connector can be secured with slots for screws.
~ Input and output push in terminals. Circular section of the cable
0,5-1,5 mm2 . The earth terminal is only for function and not for
safety purposes.
~ Anti-reverse polarity protection.
~ Installation as emergency according to VDE 0108
~ Ballasts connection in series.
~ (1) Terminal cover available for sale for independent IP20 use of this
ballast.
~ Balasto para uso “A incorporar”(1).
~ Encendido con precalentamiento de cátodos para una larga vida de
la lámpara, sin destellos ni parpadeos.
`2QVGPEKCVQVCNEQPUVCPVG[ƀWLQNWOKPQUQGUVCDKNK\CFQ
`(WPEKQPCOKGPVQGPCNVCHTGEWGPEKC#NVCGſEKGPEKCGPGTIÃVKEC
~ Efecto estroboscópico corregido.
~ Tensión permitida: AC/DC 198-264V
~ Bornes de entrada y salida de conexión rápida. Sección del
conductor circular: 0,5-1,5 mm2 . El borne de tierra del aparato es
solamente funcional.
~ Protección contra inversión de polaridad.
~ Instalación como emergencia según norma VDE 0108.
~ Conexión de equipos en serie.
~ (1) Disponibles para la venta tapas cubreclemas que permiten el uso
de este balasto como “Independiente” IP20.
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
2TQFWEVUGNGEVKQPRCICPFYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
Instructions manual on www.elt.es/productos/inst_manual.html
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
Selección de producto pág. 124 y www.elt.es/productos/buscador_producto.html
Manual de instrucciones en www.elt.es/productos/manual_instrucciones.html
Tc (ºC)
80
EN 61347-2-3 Safety / Seguridad
EN 60929 Performance / Funcionamiento
EN 61000-3-2 Harmonics / Armónicos
EN 55015 Interferences / Interferencias
EN 61547 EMC Immunity / Inmunidad CEM
Tc max = 75 ºC
70
N
60
20
40
60
80
100
96
x1000 h. Lifetime
1
2
3
4
5
6
7
8
L
9 10 11 12 13
www.elt.es
BE-TC-5-C2
220-240V
Electronic ballasts for compact lamps. 1-2 lamps
Protection class II and independent use. IP20
Balastos electrónicos para 1 o 2 lámparas compactas
con cubre-bornas. Clase II y uso “Independiente”. IP20
DC/AC 50-60Hz
153,5
32
Ø4
70,2
Modelo
Current
Power
Ref. No.
2x
1x
13
13
2x
1x
7, 9, 11
7, 9, 11
BE 213-TC-5-C2
9621190
TC-SE
TC-DD
1x
16
BE 218-TC-5-C2
9621191
TC-DE
TC-TE
2x
1x
18
18
TC-DE
TC-TE
2x
1x
26
26, 32, 42
TC-L
TC-F
2x
1x
18, 24
18, 24, 36, 40
T5C
2x
1x
22
22, 40
TC-DE
TC-TE
2x
26, 32, 42
1x 26, 32, 42, 57, 70
TC-L
TC-F
2x
1x
18, 24, 36
18, 24, 36,40
T5C
2x
1x
22
22, 40
BE 226-TC-5-C2
BE 242-TC-5-C2
9621192
9621193
1RGTCVKPI
temp.
7PKVU
RGTDQZ
Index
Temp.máx.
envolvente
(A)
NJ
tc (°C)
0,04… 0,13
0,97
75
-20... +50
20
A2
01
0,09… 0,17
0,97
75
-20... +50
20
A2
01
0,08… 0,23
0,97
75
-20... +50
20
A2
01
0,09... 0,415
0,97
75
-20... +50
20
A2
01
W
TC-DE
TC-TE
Max.temp.
CVVERQKPV
Factor
de
potencia
Intensidad
Potencia
Power
factor
Homologaciones
Model
2
160,5
170,5
Approvals
4,5
Temp.
Índice
funcionamiento Unidades
por caja
ta (°C)
EEI
~ Ballast for independent use IP20.
~ Suitable for Class II luminaires
~ Cathode preheating start for a long life of lamp. Flicker free.
~ Without stroboscopic effect.
~ Permitted input voltage:AC/DC 198-264V.
~ Input and output push in terminals. Circular section of the cable
0,5-1,5 mm2 . The earth terminal is only for function and not for
safety purposes.
~ Anti-reverse polarity protection.
~ Installation as emergency according to VDE 0108.
~ High frequency operation. High energy effciency.
`%QPUVCPVRQYGTKPNCORCPFUVCDKNKUGFNWOKPQWUƀWZ
~ Ballasts connection in series.
~ Balasto para uso “Independiente” IP20.
~ Admite su uso en luminarias clase II.
~ Encendido con precalentamiento de cátodos para una larga vida de
la lámpara, sin destellos ni parpadeos.
~ Efecto estroboscópico corregido.
~ Tensión permitida: AC/DC 198-264V.
~ Bornes de entrada y salida de conexión rápida. Sección del
conductor circular: 0,5-1,5 mm2 . El borne de tierra del aparato es
solamente funcional.
~ Protección contra inversión de polaridad.
~ Instalación como emergencia según norma VDE 0108.
`(WPEKQPCOKGPVQGPCNVCHTGEWGPEKC#NVCGſEKGPEKCGPGTIÃVKEC
`2QVGPEKCVQVCNEQPUVCPVG[ƀWLQNWOKPQUQGUVCDKNK\CFQ
~ Conexión de equipos en serie:
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
2TQFWEVUGNGEVKQPRCICPFYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
Instructions manual on www.elt.es/productos/inst_manual.html
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
Selección de producto pág. 124 y www.elt.es/productos/buscador_producto.html
Manual de instrucciones en www.elt.es/productos/manual_instrucciones.html
9KTGRTGRCTCVKQP
Preparación del cable
Tc (ºC)
15
80
EN 61347-2-3 Safety / Seguridad
EN 60929 Performance / Funcionamiento
EN 61000-3-2 Harmonics / Armónicos
EN 55015 Interferences / Interferencias
EN 61547 EMC Immunity / Inmunidad CEM
www.elt.es
7
2
H03VVH2-F 0,75 mm 2
H05VVH2-F 0,75 - 1mm
Tc max = 75 ºC
70
N
60
20
40
60
80
100
97
x1000 h. Lifetime
1
2
3
4
5
6
7
8
L
9 10 11 12 13
29,5
Ø 4,2
69 63
92,5
W
V
TC-DE
TC-TE
Z
Z
Z
Z
BE 213-TC-4-UN
9621160
TC-SE
TC-DD
Z
BE 218-TC-4-UN
9621161
TC-DE
TC-TE
Z
Z
TC-DE
TC-TE
Z
Z
TC-L
TC-F
Z
Z
T5C
Z
Z
BE 226-TC-4-UN
9621162
230V
(A)
NJ
tc (°C)
ta (°C)
Homologaciones
110V
Factor
Temp.máx.
de
envolvente
potencia
Índice
6GPUKÎP
&%#%
50-60Hz
Potencia
Index
Ref.
No.
Max.temp.
at tc point
Approvals
Modelo
Intensidad
Power
factor
Units per box
Model
Current
Voltage
DC/AC
Power
7PKFCFGURQTECLC
108
Temp. funcionamiento
DC/AC 50-60Hz
Electronic ballasts for 1 or 2 compact lamps.
Universal voltage 110-240V
%DODVWRVHOHFWUyQLFRVSDUDROiPSDUDVÀXRUHVFHQWHVFRPSDFWDV
7HQVLyQXQLYHUVDO9
Operating temp.
BE-TC-4
110-240V
EEI
110-240
0,08… 0,26
0,04… 0,13
>0,90
75
-20... +50
30
A2
01
110-240
0,18… 0,34
0,09… 0,17
>0,90
75
-20... +50
30
A2
01
110-240
0,16… 0,46
0,08… 0,23
>0,90
75
-20... +50
30
A2
01
~ Ballast for built in use (1).
~ Cathode preheating start for a long life of lamp. Flicker free.
`%QPUVCPVRQYGTKPNCORCPFUVCDKNKUGFNWOKPQWUƀWZ
~ High frequency operation. High energy effciency.
~ Without stroboscopic effect.
~ Permitted input voltage: AC: 99-264V; DC:110-264V.
~ Connector can be secured with slots for screws.
~ Input and output push in terminals. Circular section of the cable
0,5-1,5 mm2 . The earth terminal is only for function and not for
safety purposes.
~ Anti-reverse polarity protection.
~ Installation as emergency according to VDE 0108.
~ Ballasts connection in series.
~ (1) Terminal cover available for sale for independent IP20 use of this
ballast.
~ Balasto para uso “A incorporar”(1).
~ Encendido con precalentamiento de cátodos para una larga vida de
la lámpara, sin destellos ni parpadeos.
`2QVGPEKCVQVCNEQPUVCPVG[ƀWLQNWOKPQUQGUVCDKNK\CFQ
`(WPEKQPCOKGPVQGPCNVCHTGEWGPEKC#NVCGſEKGPEKCGPGTIÃVKEC
`'HGEVQGUVTQDQUEÎRKEQEQTTGIKFQ
`6GPUKÎPRGTOKVKFC#%8&%8
`$QTPGUFGGPVTCFC[UCNKFCFGEQPGZKÎPT¶RKFC5GEEKÎPFGN
EQPFWEVQTEKTEWNCTOO'NDQTPGFGVKGTTCFGNCRCTCVQGU
solamente funcional.
`2TQVGEEKÎPEQPVTCKPXGTUKÎPFGRQNCTKFCF
`+PUVCNCEKÎPEQOQGOGTIGPEKCUGIÕPPQTOC8&'
`%QPGZKÎPFGGSWKRQUGPUGTKG
~ (1) &KURQPKDNGURCTCNCXGPVCVCRCUEWDTGENGOCUSWGRGTOKVGPGNWUQ
FGGUVGDCNCUVQEQOQő+PFGRGPFKGPVGŒ+2
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
2TQFWEVUGNGEVKQPRCICPFYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
Instructions manual on www.elt.es/productos/inst_manual.html
'ODCNCLG[RGUQR¶I[YYYGNVGURTQFWEVQUGODCNCLGA'.6RFH
5GNGEEKÎPFGRTQFWEVQR¶I[YYYGNVGURTQFWEVQUDWUECFQTARTQFWEVQJVON
/CPWCNFGKPUVTWEEKQPGUGPYYYGNVGURTQFWEVQUOCPWCNAKPUVTWEEKQPGUJVON
Tc (ºC)
80
EN 61347-2-3 Safety / 5GIWTKFCF
EN 60929 Performance / Funcionamiento
EN 61000-3-2 Harmonics / #TOÎPKEQU
EN 55015 Interferences / Interferencias
EN 61547 EMC Immunity / +POWPKFCF%'/
Tc max = 75 ºC
70
N
60
20
40
60
80
100
98
x1000 h. Lifetime
1
2
3
4
5
6
7
8
L
9 10 11 12 13
www.elt.es
Electronic ballasts for 1 or 2 compact lamps. Protection Class II
and independent use. IP20. Universal voltage 110-240V
%DODVWRVHOHFWUyQLFRVSDUDROiPSDUDVÀXRUHVFHQWHVFRPSDFWDV
FRQFXEUHERUQDV&ODVH,,\XVRLQGHSHQGLHQWH,3
7HQVLyQXQLYHUVDO9
BE-TC-4-C2
110-240V
DC/AC 50-60Hz
153,5
32
Ø4
70,2
W
V
TC-DE
TC-TE
Z
Z
Z
Z
BE 213-TC-4-UN-C2
9621170
TC-SE
TC-DD
Z
BE 218-TC-4-UN-C2
9621171
TC-DE
TC-TE
Z
Z
TC-DE
TC-TE
Z
Z
TC-L
TC-F
Z
Z
T5C
Z
Z
BE 226-TC-4-UN-C2
9621172
(A)
NJ
tc (°C)
ta (°C)
Índice
Homologaciones
230V
Approvals
110V
Factor
Temp.máx.
de
envolvente
potencia
Index
Tensión
&%#%
50-60Hz
Potencia
Max.temp.
at tc point
7PKFCFGURQTECLC
Ref.
No.
Intensidad
Power
factor
Units per box
Modelo
Current
Voltage
DC/AC
Power
Temp. funcionamiento
Model
2
160,5
170,5
Operating temp.
4,5
EEI
110-240
0,08… 0,26
0,04… 0,13
>0,90
75
-20... +50
20
A2
01
110-240
0,18… 0,34
0,09… 0,17
>0,90
75
-20... +50
20
A2
01
110-240
0,16… 0,46
0,08… 0,23
>0,90
75
-20... +50
20
A2
01
~ Ballast for independent use IP20.
~ Suitable for Class II luminaires
~ Cathode preheating start for a long life of lamp. Flicker free.
~ Without stroboscopic effect.
~ Permitted input voltage: AC: 99-264V; DC:110-264V
~ Input and output push in terminals. Circular section of the cable
0,5-1,5 mm2 . The earth terminal is only for function and not for
safety purposes.
~ Anti-reverse polarity protection.
~ Installation as emergency according to VDE 0108.
~ High frequency operation. High energy effciency.
`%QPUVCPVRQYGTKPNCORCPFUVCDKNKUGFNWOKPQWUƀWZ
~ Ballasts connection in series.
~ Balasto para uso “Independiente” IP20.
~ Admite su uso en luminarias clase II.
~ Encendido con precalentamiento de cátodos para una larga vida de
la lámpara, sin destellos ni parpadeos.
~ Efecto estroboscópico corregido.
~ Tensión permitida: AC: 99-264V; DC:110-264V.
~ Bornes de entrada y salida de conexión rápida. Sección del
conductor circular: 0,5-1,5 mm2 . El borne de tierra del aparato es
solamente funcional.
~ Protección contra inversión de polaridad.
~ Instalación como emergencia según norma VDE 0108.
`(WPEKQPCOKGPVQGPCNVCHTGEWGPEKC#NVCGſEKGPEKCGPGTIÃVKEC
`2QVGPEKCVQVCNEQPUVCPVG[ƀWLQNWOKPQUQGUVCDKNK\CFQ
~ Conexión de equipos en serie.
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
2TQFWEVUGNGEVKQPRCICPFYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
Instructions manual on www.elt.es/productos/inst_manual.html
'ODCNCLG[RGUQR¶I[YYYGNVGURTQFWEVQUGODCNCLGA'.6RFH
5GNGEEKÎPFGRTQFWEVQR¶I[YYYGNVGURTQFWEVQUDWUECFQTARTQFWEVQJVON
/CPWCNFGKPUVTWEEKQPGUGPYYYGNVGURTQFWEVQUOCPWCNAKPUVTWEEKQPGUJVON
Wire preparation
Preparación del cable
Tc (ºC)
15
80
EN 61347-2-3 Safety / Seguridad
EN 60929 Performance / Funcionamiento
EN 61000-3-2 Harmonics / Armónicos
EN 55015 Interferences / Interferencias
EN 61547 EMC Immunity / Inmunidad CEM
www.elt.es
7
2
H03VVH2-F 0,75 mm 2
H05VVH2-F 0,75 - 1mm
Tc max = 75 ºC
70
N
60
20
40
60
80
100
99
x1000 h. Lifetime
1
2
3
4
5
6
7
8
L
9 10 11 12 13
BE-2
220-240V
50-60Hz
(OHFWURQLFEDOODVWVIRURUÀXRUHVFHQWODPSV
T8 / TC-L / T5 MULTIPOWER TECHNOLOGY
Balastos electrónicos para 1 o OiPSDUDVÀXRUHVFHQWHV
T8 / TC-L / T5 TECNOLOGÍA MULTIPOTENCIA
40
28
4,25
5
5
220
230
1 LAMP BALLASTS / BALASTOS PARA 1 LÁMPARA
Model
Modelo
Power
Ref. No.
Potencia
W
BE 136-2
9610111
T8
TC-L
T5
BE 158-2
9610013
T8
TC-L
T5
Power
factor
Max.temp.
CVVERQKPV
1RGTCVKPI
temp.
7PKVURGT Index
Approvals
DQZ
Factor
Intensidad
Temp.máx.
Temp.
Índice Homologaciones
de
envolvente funcionamiento Unidades
potencia
por caja
Current
(A)
NJ
tc (°C)
ta (°C)
18, 30, 36W (*)
18, 36W
24,39W
EEI
0,09... 0,19
0,95
70
-20... +50
24
A2
(*)
01
58W(*)
55W
54W
0,24... 0,27
0,95
70
-20... +50
24
A2
(*)
01
1 OR 2 LAMPS BALLASTS / BALASTOS PARA 1 O 2 LÁMPARAS
BE 236-2
9620014
T8
TC-L
T5
1x 2x 18, 30, 36W (*)
1x 2x
18, 36W
1x 2x
24,39W
0,09... 0,31
0,98
70
-20... +50
24
A2
(*)
01
BE 258-2
9620013
T8
TC-L
T5
1x 2x
1x 2x
1x 2x
0,24... 0,48
0,98
70
-20... +50
24
A2
(*)
01
58W(*)
55W
54W
~ BE 236-2 and BE 258-2 Ballasts can be connected to one or two
lamps (see diagram).
~ Class I ballast for built-in use.
~ Ignition with preheating in cathodes for a long life in the lamp,
YKVJQWVƀCUJGUQTƀKEMGTKPI
`%QPUVCPVVQVCNRQYGTCPFUVCDKNK\GFNWOKPQWUƀWZ
`*KIJHTGSWGPE[QRGTCVKQP*KIJGPGTI[GHſEKGPE[
~ Corrected stroboscopic effect.
~ Allows the use of Class I and Class II luminaires without
screening to earth in the lamps.
~ Permitted input voltage: 198-264V, 50-60Hz.
~ Withstands 2 hours at 350V (A/C).
`4CRKFEQPPGEVKQPEQPPGEVQTYKVJſZKPIURTKPI%KTEWNCT
conductor section: 0,5-1,5 mm2 .
~ Connection terminals for automatic luminaire wiring (ALF
connections) available upon request.
~ Los balastos BE 236-2 y BE 258-2 pueden ser conectados a una
o dos lámparas (ver esquema).
~ Balasto a incorporar Clase I.
~ Encendido con precalentamiento de cátodos para una larga vida
de la lámpara, sin destellos, ni parpadeos.
`2QVGPEKCVQVCNEQPUVCPVG[ƀWLQNWOKPQUQGUVCDKNK\CFQ
`(WPEKQPCOKGPVQGPCNVCHTGEWGPEKC#NVCGſEKGPEKCGPGTIÃVKEC
~ Efecto estroboscópico corregido.
~ Utilizable en luminarias de Clase I y Clase II sin
apantallamiento a tierra de las lámparas.
~ Tensión permitida 198-264V, 50-60Hz.
~ Soporta 2 horas a 350V (A/C).
`%QPGEVQTGUFGEQPGZKÎPT¶RKFCEQPOWGNNGFGſLCEKÎP5GEEKÎP
del conductor circular: 0,5-1,5 mm2 .
~ Disponible bajo pedido con bornes para cableado automático de
luminarias sistema (ALF).
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
2TQFWEVUGNGEVKQPRCICPFYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
Instructions manual on www.elt.es/productos/inst_manual.html
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
Selección de producto pág. 124 y www.elt.es/productos/buscador_producto.html
Manual de instrucciones en www.elt.es/productos/manual_instrucciones.html
2 LAMPS
1 LAMP
1
2
Tc (ºC)
80
60
20
40
60
80
100
100
x1000 h. Lifetime
LAMP
2
3
3
5
5
6
6
7
7
LAMP
LAMP
2 LAMPS TC-L
1 LAMP TC-L
Tc max = 70 ºC
70
EN 61347-2-3 Safety / Seguridad
EN 60929 Performance / Funcionamiento
EN 61000-3-2 Harmonics / Armónicos
EN 55015 Interferences / Interferencias
EN 61547 EMC Immunity / Inmunidad CEM
1
1
1
2
2
3
3
5
5
6
6
7
7
www.elt.es
(OHFWURQLFEDOODVWVIRURUÀXRUHVFHQWODPSV7
%DODVWRVHOHFWUyQLFRVSDUDROiPSDUDVÀXRUHVFHQWHV7
BE-3
220-240V
DC/AC 50-60Hz
40
28
4,25
5
5
220
230
1 LAMP BALLASTS / BALASTOS PARA 1 LÁMPARA
Model
Modelo
Current
Power
Ref. No.
Power
factor
Factor
de
potencia
Intensidad
Potencia
W
BE 136-3
9610150
T8
18,36W (*)
BE 158-3
9610160
T8
58W
Max.
temp. at
VERQKPV
1RGTCVKPI
temp.
7PKVU
RGTDQZ
Index
Approvals
Temp.
Temp.
Índice Homologaciones
máx.
funcionamiento Unidades
por caja
envolvente
(A)
NJ
tc (°C)
ta (°C)
0,095... 0,165
0,97
75
-25... +55
24
EEI
A2
0,25
0,97
75
-25... +55
24
A2
(*)
01
01
1 OR 2 LAMPS BALLASTS / BALASTOS PARA 1 O 2 LÁMPARAS
BE 236-3
9621020
T8
BE 258-3
9621030
T8
1x 2x 18,36W (*)
58W
0,17... 0,31
0,98
75
-25... +55
24
A2
0,48
0,98
75
-25... +55
24
A2
1x 2x
(*)
01
01
~ Class I ballast for built-in use.
~ High frecuency electronic ballasts with cathode preheating (warm
instant start). Flicking free, without stroboscopic effect and silent
operation.
~ Constant power in lamp in case of mains voltage variations.
~ End-of-life lamp rectifying effect detection.
~ Suitable for Class I and Class II luminaires.
~ Withstands 2 hours at 350V (A/C).
~ Permitted input voltage: AC:198-264V; DC: 150-270V.
`4CRKFEQPPGEVKQPEQPPGEVQTYKVJſZKPIURTKPI%KTEWNCTEQPFWEVQT
section: 0,5-1,5 mm2 .
~ Anti-reverse polarity protection.
~ Connection terminals for automatic luminaire wiring (ALF
connections) available upon request.
~ Balasto a incorporar Clase I.
~ Encendido con precalentamiento de cátodos para una larga vida
de la lámpara, sin destellos, ni parpadeos. Efecto estroboscópico
corregido
~ Potencia constante en lámpara frente a variaciones de la tensión
de red.
`&GVGPEKÎPFGN¶ORCTCCIQVCFC[GHGEVQTGEVKſECFQT
~ Permite el uso en luminarias de Clase I y Clase II sin
apantallamiento a tierra de las lámparas.
~ Soporta 2 horas a 350v (A/C).
~ Tensión permitida: AC: 198 - 264V; DC: 150 - 270V.
`%QPGEVQTGUFGEQPGZKÎPT¶RKFCEQPOWGNNGFGſLCEKÎP
Sección del conductor circular 0,5...1,5 mm2 .
~ Protección contra inversión de polaridad.
~ Disponible bajo pedido con bornes para cableado automático de
luminarias sistema (ALF).
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
2TQFWEVUGNGEVKQPRCICPFYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
Instructions manual on www.elt.es/productos/inst_manual.html
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
Selección de producto pág. 124 y www.elt.es/productos/buscador_producto.html
Manual de instrucciones en www.elt.es/productos/manual_instrucciones.html
Tc (ºC)
EN 61347-2-3 Safety / Seguridad
EN 60929 Performance / Funcionamiento
EN 61000-3-2 Harmonics / Armónicos
EN 55015 Interferences / Interferencias
EN 61547 EMC Immunity / Inmunidad CEM
www.elt.es
2 LAMPS
1 LAMP
80
Tc max = 75 ºC
1
LAMP
1
2
70
2
3
3
60
5
5
6
6
7
7
20
40
60
80
101
100
x1000 h. Lifetime
LAMP
LAMP
40
28
4,25
5
5
220
230
.#/2$#..#565BALASTOS PARA 1 LÁMPARA
Power
factor
Current
Model
Modelo
BE 118-4-UN
BE 136-4-UN
BE 158-4-UN
Power
Ref. No.
9610141
9610161
Voltage DC/AC
Potencia
Tensión DC/AC
50-60Hz
W
V
6
6
6
6
9
15W
36W
9
Intensidad
110V
230V
Max.temp.
at tc point
Operating
temp.
Factor
de
potencia
Temp.máx.
envolvente
Temp.
funcionamiento
NJ
tc (°C)
ta (°C)
70
-25... +55
(A)
110-240
0,17
110-240
0,33
110-240
0,52
0,16
70
0,25
70
-25... +55
-25... +55
Units per
box
Index
Índice
Unidades
RQTECLC
EEI
24
24
24
Homologaciones
DC/AC 50-60Hz
(OHFWURQLFEDOODVWVIRUÀXRUHVFHQWODPS7
Universal voltage 110-240V
%DODVWRVHOHFWUyQLFRVSDUDOiPSDUDÀXRUHVFHQWH7
7HQVLyQXQLYHUVDO9
Approvals
BE-4-UN
110-240V
A2
(*)
01
A2
(*)
01
A2
(*)
01
~ Class I ballast for built-in use.
~ Ignition with preheating in cathodes for a long life in the lamp,
YKVJQWVƀCUJGUQTƀKEMGTKPI
`%QPUVCPVVQVCNRQYGTCPFUVCDKNK\GFNWOKPQWUƀWZ
`*KIJHTGSWGPE[QRGTCVKQP*KIJGPGTI[GHſEKGPE[
~ Corrected stroboscopic effect.
~ Allows the use of Class I and Class II luminaires without screening
to earth in the lamps.
~ Permitted input voltage AC/DC: 99-264V.
~ Withstands 2 hours at 350V (A/C).
`4CRKFEQPPGEVKQPEQPPGEVQTYKVJſZKPIURTKPI%KTEWNCTEQPFWEVQT
section: 0,5-1,5 mm2 .
~ Anti-reverse polarity protection.
~ Connection terminals for automatic luminaire wiring (ALF
connections) available upon request.
'0'%%GTVKſECVGHQT8
~ Balasto a incorporar Clase I.
~ Encendido con precalentamiento de cátodos para una larga vida de
la lámpara, sin destellos, ni parpadeos.
`2QVGPEKCVQVCNEQPUVCPVG[ƀWLQNWOKPQUQGUVCDKNK\CFQ
`(WPEKQPCOKGPVQGPCNVCHTGEWGPEKC#NVCGſEKGPEKCGPGTIÃVKEC
`'HGEVQGUVTQDQUEÎRKEQEQTTGIKFQ
~ Permite el uso en luminarias de Clase I y Clase II sin
apantallamiento a tierra de las lámparas.
~ Tensión permitida AC/DC: 99-264V.
~ Soporta 2 horas a 350V (A/C).
`%QPGEVQTGUFGEQPGZKÎPT¶RKFCEQPOWGNNGFGſLCEKÎP5GEEKÎPFGN
conductor circular: 0,50-1,5 mm2 .
~ Protección contra inversión de polaridad.
`&KURQPKDNGDCLQRGFKFQEQPDQTPGURCTCECDNGCFQCWVQO¶VKEQFG
luminarias sistema (ALF).
%GTVKſECFQ'0'%RCTCVGPUKÎPFGTGF8
2CEMCIKPICPFYGKIJVRCICPFYYYGNVGURTQFWEVQURCEMCIKPIA'.6RFH
2TQFWEVUGNGEVKQPRCICPFYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
+PUVTWEVKQPUOCPWCNQPYYYGNVGURTQFWEVQUKPUVAOCPWCNJVON
'ODCNCLG[RGUQR¶I[YYYGNVGURTQFWEVQUGODCNCLGA'.6RFH
5GNGEEKÎPFGRTQFWEVQR¶I[YYYGNVGURTQFWEVQUDWUECFQTARTQFWEVQJVON
/CPWCNFGKPUVTWEEKQPGUGPYYYGNVGURTQFWEVQUOCPWCNAKPUVTWEEKQPGUJVON
Tc (ºC)
80
1
2
EN 61347-2-3 Safety / Seguridad
EN 60929 Performance / Funcionamiento
EN 61000-3-2 Harmonics / Armónicos
EN 55015 Interferences / Interferencias
EN 61547 EMC Immunity / Inmunidad CEM
LAMP
Tc max = 70 ºC
70
60
6
20
40
60
80
102
100
x1000 h. Lifetime
7
www.elt.es
(OHFWURQLFEDOODVWVIRURUÀXRUHVFHQWODPSV7
Universal voltage 110-240V
%DODVWRVHOHFWUyQLFRVSDUDROiPSDUDVÀXRUHVFHQWHV7
7HQVLyQXQLYHUVDO9
BE-4-UN
110-240V
DC/AC 50-60Hz
40
28
4,25
5
5
220
230
V
Temp.
funcionamiento
230V
Factor
de
potencia
Temp.máx.
envolvente
(A)
Homologaciones
W
110V
Operating
temp.
Índice
Tensión
DC/AC
50-60Hz
Potencia
Max.temp.
at tc point
Index
Ref.
No.
Intensidad
Approvals
Modelo
Power
Power
factor
Units per box
Model
Current
Voltage
DC/AC
7PKFCFGURQTECLC
14.#/25$#..#565BALASTOS PARA 1 O 2 LÁMPARAS
NJ
tc (°C)
ta (°C)
BE 218-4-UN
9621011
ZZ9
ZZ9
600mm
450mm
110-240
0,17... 0,33
70
-20... +55
24
EEI
A2
(*)
01
BE 236-4-UN
9621021
ZZ9
ZZ9
1200mm
600mm
110-240
0,33... 0,64
0,17... 0,31
70
-20... +50
24
A2
(*)
01
0,97
70
-20... +55
24
A2
14.#/25$#..#565BALASTOS PARA 3 O 4 LÁMPARAS
BE 418-4-UN
9640017
ZZ9
600mm
110-240
0,54... 0,70
0,26... 0,35
-
~ Class I ballast for built-in use.
~ Ignition with preheating in cathodes for a long life in the lamp,
YKVJQWVƀCUJGUQTƀKEMGTKPI
`%QPUVCPVVQVCNRQYGTCPFUVCDKNK\GFNWOKPQWUƀWZ
`*KIJHTGSWGPE[QRGTCVKQP*KIJGPGTI[GHſEKGPE[
~ Corrected stroboscopic effect.
~ Allows the use of Class I and Class II luminaires without screening
to earth in the lamps.
~ Permitted input voltage AC/DC: 99-264V.
~ Withstands 2 hours at 350V (A/C).
`4CRKFEQPPGEVKQPEQPPGEVQTYKVJſZKPIURTKPI%KTEWNCTEQPFWEVQT
section: 0,5-1,5 mm2 .
~ Anti-reverse polarity protection.
~ Connection terminals for automatic luminaire wiring (ALF
connections) available upon request.
'0'%%GTVKſECVGHQT8
~ Balasto a incorporar Clase I.
~ Encendido con precalentamiento de cátodos para una larga vida de
la lámpara, sin destellos, ni parpadeos.
`2QVGPEKCVQVCNEQPUVCPVG[ƀWLQNWOKPQUQGUVCDKNK\CFQ
`(WPEKQPCOKGPVQGPCNVCHTGEWGPEKC#NVCGſEKGPEKCGPGTIÃVKEC
`'HGEVQGUVTQDQUEÎRKEQEQTTGIKFQ
~ Permite el uso en luminarias de Clase I y Clase II sin
apantallamiento a tierra de las lámparas.
~ Tensión permitida AC/DC: 99-264V.
~ Soporta 2 horas a 350V (A/C).
`%QPGEVQTGUFGEQPGZKÎPT¶RKFCEQPOWGNNGFGſLCEKÎP5GEEKÎPFGN
conductor circular: 0,50-1,5 mm2 .
~ Protección contra inversión de polaridad.
`&KURQPKDNGDCLQRGFKFQEQPDQTPGURCTCECDNGCFQCWVQO¶VKEQFG
luminarias sistema (ALF).
%GTVKſECFQ'0'%RCTCVGPUKÎPFGTGF8
2CEMCIKPICPFYGKIJVRCICPFYYYGNVGURTQFWEVQURCEMCIKPIA'.6RFH
2TQFWEVUGNGEVKQPRCICPFYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
+PUVTWEVKQPUOCPWCNQPYYYGNVGURTQFWEVQUKPUVAOCPWCNJVON
'ODCNCLG[RGUQR¶I[YYYGNVGURTQFWEVQUGODCNCLGA'.6RFH
5GNGEEKÎPFGRTQFWEVQR¶I[YYYGNVGURTQFWEVQUDWUECFQTARTQFWEVQJVON
/CPWCNFGKPUVTWEEKQPGUGPYYYGNVGURTQFWEVQUOCPWCNAKPUVTWEEKQPGUJVON
1 LAMP
1
2
Tc (ºC)
80
www.elt.es
LAMP
2
3
3
5
5
6
6
7
7
3 LAMPS
Tc max = 70 ºC
70
EN 61347-2-3 Safety / Seguridad
EN 60929 Performance / Funcionamiento 60
EN 61000-3-2 Harmonics / Armónicos
EN 55015 Interferences / Interferencias
EN 61547 EMC Immunity / Inmunidad CEM
2 LAMPS
1
7
8
9
10
LAMP
LAMP
20
40
60
80
100
103
x1000 h. Lifetime
LAMP
4 LAMPS
1
7
2
8
3
9
10
4
LAMP
LAMP
LAMP
LAMP
LAMP
5
6
LAMP
1
2
3
4
5
6
BE-UN
110-277V
DC/AC 50-60Hz
(OHFWURQLFEDOODVWVIRURUÀXRUHVFHQWODPSV7RU7
Universal voltage 110-277V
%DODVWRVHOHFWUyQLFRVSDUDROiPSDUDVÀXRUHVFHQWHV7R7
Tensión universal 110-277V
40
28
4,25
5
5
220
230
1 OR 2 LAMPS BALLASTS / BALASTOS PARA 1 O 2 LÁMPARAS
Model
Modelo
Power
Ref.
No.
Current
Voltage
DC/AC
Intensidad
Tensión
DC/AC
50-60Hz
Potencia
W
110V
1RGTCVKPI
temp.
7PKVU Index
RGTDQZ
Factor
Temp.
Temp.
Índice
de
máx.
funcionamiento Unidades
potencia envolvente
por caja
NJ
tc (°C)
ta (°C)
9610250 T8
T5
1x
1x
58W
54W
1500mm
1150mm
110-277
0,50... 0,60
0,20... 0,25
0,98
70
-20... +50
24
A3
BE 236-UN-277V
9620110 T8
T8
1x 2x 36W
1x 2x 18W
1200mm
600mm
110-277
0,35... 0,60
0,15... 0,25
0,95
70
-20... +50
24
A3
1x 2x
1x 2x
1x 2x
1x
549mm
850mm
1149mm
1449mm
110-277
0,20... 0,60
0,10... 0,25
0,95
70
-20... +50
24
A2
14W
21W
28W
35W
(A)
Max.temp.
CVVERQKPV
BE 158-UN-277V
T5
BE 214-28-UN-277V 9620109 T5
T5
T5
V
277V
Power
factor
EEI
~ Class I ballast for built-in use.
~ Ignition with preheating in cathodes for a long life in the lamp,
YKVJQWVƀCUJGUQTƀKEMGTKPI
`%QPUVCPVVQVCNRQYGTCPFUVCDKNK\GFNWOKPQWUƀWZ
`*KIJHTGSWGPE[QRGTCVKQP*KIJGPGTI[GHſEKGPE[
~ Corrected stroboscopic effect.
~ Allows the use of Class I and Class II luminaires without screening
to earth in the lamps.
~ Withstands 2 hours at 350V (A/C).
~ Permitted input voltage AC/DC: 99-305V.
`4CRKFEQPPGEVKQPEQPPGEVQTYKVJſZKPIURTKPI%KTEWNCTEQPFWEVQT
section: 0,5-1,5 mm2 .
~ Anti-reverse polarity protection.
~ Connection terminals for automatic luminaire wiring (ALF
connections) available upon request.
~ Balasto a incorporar Clase I.
~ Encendido con precalentamiento de cátodos para una larga vida de
la lámpara, sin destellos, ni parpadeos.
`2QVGPEKCVQVCNEQPUVCPVG[ƀWLQNWOKPQUQGUVCDKNK\CFQ
`(WPEKQPCOKGPVQGPCNVCHTGEWGPEKC#NVCGſEKGPEKCGPGTIÃVKEC
~ Efecto estroboscópico corregido.
~ Permite el uso en luminarias de Clase I y Clase II sin
apantallamiento a tierra de las lámparas.
~ Tensión permitida AC/DC: 99-305V.
~ Soporta 2 horas a 350V (A/C).
`%QPGEVQTGUFGEQPGZKÎPT¶RKFCEQPOWGNNGFGſLCEKÎP5GEEKÎPFGN
conductor circular: 0,50-1,5 mm2 .
~ Protección contra inversión de polaridad.
~ Disponible bajo pedido con bornes para cableado automático de
luminarias sistema (ALF).
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
2TQFWEVUGNGEVKQPRCICPFYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
Instructions manual on www.elt.es/productos/inst_manual.html
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
Selección de producto pág. 124 y www.elt.es/productos/buscador_producto.html
Manual de instrucciones en www.elt.es/productos/manual_instrucciones.html
1 LAMP
Tc (ºC)
80
1
EN 61347-2-3 Safety / Seguridad
EN 60929 Performance / Funcionamiento
EN 61000-3-2 Harmonics / Armónicos
EN 55015 Interferences / Interferencias
EN 61547 EMC Immunity / Inmunidad CEM
Tc max = 70 ºC
70
60
20
40
60
80
104
100
x1000 h. Lifetime
2
LAMP
2 LAMPS
1
2
3
3
5
5
6
6
7
7
LAMP
LAMP
www.elt.es
(OHFWURQLFEDOODVWVIRURUÀXRUHVFHQWODPSV
T8 / TC-L 18W
%DODVWRVHOHFWUyQLFRVSDUDROiPSDUDVÀXRUHVFHQWHV
de 18W T8 / TC-L
BE-2
220-240V
50-60Hz
40
28
4,25
5
5
220
230
3 OR 4 LAMPS BALLASTS / BALASTOS PARA 3 O 4 LÁMPARAS
Model
Modelo
Power
Ref. No.
Potencia
W
BE 418-2
9640011
T8
TC-L
3x 4x 18W (*)
3x 4x
18W
Power
factor
Current
Intensidad Factor de
potencia
Max.temp. at tc
RQKPV
1RGTCVKPI
temp.
Temp.máx.
envolvente
Temp.
funcionamiento
(A)
NJ
tc (°C)
ta (°C)
0,325
0,98
70
-20... +55
7PKVURGT Index
DQZ
Índice
Unidades
por caja
Approvals
Homologaciones
EEI
24
A2
(*)
01
~ Class I ballast for built-in use.
~ Ignition with preheating in cathodes for a long life in the lamp,
YKVJQWVƀCUJGUQTƀKEMGTKPI
`%QPUVCPVVQVCNRQYGTCPFUVCDKNK\GFNWOKPQWUƀWZ
`*KIJHTGSWGPE[QRGTCVKQP*KIJGPGTI[GHſEKGPE[
~ Corrected stroboscopic effect.
~ Allows the use of Class I and Class II luminaires without screening
to earth in the lamps.
~ Permitted input voltage 198-264V, 50-60Hz.
~ Withstands 2 hours at 350V (A/C).
`4CRKFEQPPGEVKQPEQPPGEVQTYKVJſZKPIURTKPI%KTEWNCTEQPFWEVQT
section: 0,5-1,5 mm2 .
~ Connection terminals for automatic luminaire wiring (ALF
connections) available upon request.
~ Balasto a incorporar Clase I.
~ Encendido con precalentamiento de cátodos para una larga vida de
la lámpara, sin destellos, ni parpadeos.
`2QVGPEKCVQVCNEQPUVCPVG[ƀWLQNWOKPQUQGUVCDKNK\CFQ
`(WPEKQPCOKGPVQGPCNVCHTGEWGPEKC#NVCGſEKGPEKCGPGTIÃVKEC
~ Efecto estroboscópico corregido.
~ Permite el uso en luminarias de Clase I y Clase II sin
apantallamiento a tierra de las lámparas.
~ Tensión permitida 198-264V, 50-60Hz.
~ Soporta 2 horas a 350V (A/C).
`%QPGEVQTGUFGEQPGZKÎPT¶RKFCEQPOWGNNGFGſLCEKÎP5GEEKÎPFGN
conductor circular: 0,5-1,5 mm2 .
~ Disponible bajo pedido con bornes para cableado automático de
luminarias sistema sistema (ALF).
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
2TQFWEVUGNGEVKQPRCICPFYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
Instructions manual on www.elt.es/productos/inst_manual.html
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
Selección de producto pág. 124 y www.elt.es/productos/buscador_producto.html
Manual de instrucciones en www.elt.es/productos/manual_instrucciones.html
3 LAMPS
7
1
LAMP
8
9
2
3
LAMP
10
4
5
LAMP
6
Tc (ºC)
80
EN 61347-2-3 Safety / Seguridad
EN 60929 Performance / Funcionamiento
EN 61000-3-2 Harmonics / Armónicos
EN 55015 Interferences / Interferencias
EN 61547 EMC Immunity / Inmunidad CEM
www.elt.es
4 LAMPS
Tc max = 70 ºC
70
7
8
9
10
60
LAMP
LAMP
LAMP
20
40
60
80
105
100
x1000 h. Lifetime
LAMP
1
2
3
4
5
6
BE-2
220-240V
50-60Hz
(OHFWURQLFEDOODVWVRUÀXRUHVFHQWODPSV77&/7
MULTIPOWER TECHNOLOGY
%DODVWRVHOHFWUyQLFRVSDUDROiPSDUDVÀXRUHVFHQWHV77&/7
TECNOLOGÍA MULTIPOTENCIA
40
28
4,25
5
5
350
360
3 OR 4 LAMPS BALLASTS / BALASTOS PARA 3 O 4 LÁMPARAS
Model
Modelo
BE 436-2
Ref. No.
9640008
T8
TC-L
T5
T5
Power
factor
Max.temp. at
VERQKPV
Intensidad
Factor de
potencia
Temp.máx.
envolvente
(A)
NJ
tc (°C)
ta (°C)
0,25... 0,63
0,98
70
-20... +50
Power
Current
Potencia
W
3x 4x 18, 30, 36W (*)
3x 4x
18, 36W
3x 4x
24W
39W
3x
1RGTCVKPI
temp.
7PKVURGT Index
DQZ
Temp.
Índice
funcionamiento Unidades
por caja
Approvals
Homologaciones
EEI
18
A2
(*)
01
~ BE 436-2 ballasts con be connected to three or four lamps
(see diagram).
~ Class I ballast for built-in use.
~ Ignition with preheating in cathodes for a long life in the lamp,
YKVJQWVƀCUJGUQTƀKEMGTKPI
`%QPUVCPVVQVCNRQYGTCPFUVCDKNK\GFNWOKPQWUƀWZ
`*KIJHTGSWGPE[QRGTCVKQP*KIJGPGTI[GHſEKGPE[
~ Corrected stroboscopic effect.
~ Allows the use of Class I and Class II luminaires without
screening to earth in the lamps.
~ Permitted input voltage 198-254V, 50-60Hz.
~ Withstands 2 hours at 350V (A/C).
`4CRKFEQPPGEVKQPEQPPGEVQTYKVJſZKPIURTKPI%KTEWNCT
conductor section: 0,5-1,5 mm2 .
~ Connection terminals for automatic luminaire wiring (ALF
connections) available upon request.
~ Los balastos BE 436-2 pueden ser conectados a tres o cuatro
lámparas (ver esquema).
~ Balasto a incorporar Clase I.
~ Encendido con precalentamiento de cátodos para una larga vida
de la lámpara, sin destellos, ni parpadeos.
`2QVGPEKCVQVCNEQPUVCPVG[ƀWLQNWOKPQUQGUVCDKNK\CFQ
`(WPEKQPCOKGPVQGPCNVCHTGEWGPEKC#NVCGſEKGPEKCGPGTIÃVKEC
~ Efecto estroboscópico corregido.
~ Permite el uso en luminarias de Clase I y Clase II sin
apantallamiento a tierra de las lámparas.
~ Tensión permitida 198-254V, 50-60Hz.
~ Soporta 2 horas a 350V (A/C).
`%QPGEVQTGUFGEQPGZKÎPT¶RKFCEQPOWGNNGFGſLCEKÎP
Sección del conductor circular: 0,5-1,5 mm2 .
~ Disponible bajo pedido con bornes para cableado automático de
luminarias sistema (ALF).
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
2TQFWEVUGNGEVKQPRCICPFYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
Instructions manual on www.elt.es/productos/inst_manual.html
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
Selección de producto pág. 124 y www.elt.es/productos/buscador_producto.html
Manual de instrucciones en www.elt.es/productos/manual_instrucciones.html
3 LAMPS
LAMP
12
11
10
9
LAMP
LAMP
Tc (ºC)
80
EN 61347-2-3 Safety / Seguridad
EN 60929 Performance / Funcionamiento
EN 61000-3-2 Harmonics / Armónicos
EN 55015 Interferences / Interferencias
EN 61547 EMC Immunity / Inmunidad CEM
1
2
3
4
5
6
7
8
4 LAMPS
LAMP
Tc max = 70 ºC
70
12
11
10
9
60
20
40
60
80
106
100
x1000 h. Lifetime
LAMP
LAMP
LAMP
1
2
3
4
5
6
7
8
www.elt.es
(OHFWURQLF683(56/,0EDOODVWVIRURUÀXRUHVFHQWODPSV
T5-HE and T5-HO
%DODVWRVHOHFWUyQLFRV683(56/,0SDUDROiPSDUDVÀXRUHVFHQWHV
T5-HE y T5-HO
5
312
7
24
21
4,5
8,5
4,25
5
5
314
324
Modelo
Ref.
No.
Potencia
Tensión AC
50-60Hz
W
Power
factor
Current
Intensidad
Max.temp.
CVVERQKPV
1RGTCVKPI
temp.
Factor
de
potencia
Temp.máx.
envolvente
Temp.
funcionamiento
7PKVURGT
DQZ
Unidades
por caja
Index
Índice
Homologaciones
Model
Voltage AC
Power
Approvals
1 LAMP BALLASTS / BALASTOS PARA 1 LÁMPARA
8v
(A)
NJ
tc (°C)
ta (°C)
BE 114-35-T5-S
9610030
14, 21, 28, 35W
220-240
0,078... 0,172
0,97
70
-20... +55
28
A2
01
BE 124-T5-S
9610031
24W
220-240
0,124
0,98
70
-20... +50
28
A2
01
BE 139-T5-S
9610032
39W
220-240
0,19
0,98
70
-20... +55
28
A2
01
BE 149-T5-S
9610033
49W
220-240
0,24
0,98
70
-20... +55
28
A2
01
BE 154-T5-S
9610034
54W
220-240
0,26
0,98
70
-20... +55
28
A2
01
BE 180-T5-S
9610035
80W
220-240
0,38
0,98
70
-20... +50
28
A2
01
EEI
2 LAMPS BALLASTS / BALASTOS PARA 2 LÁMPARAS
BE 214-35-T5-S
9620070
14, 21, 28, 35W
220-240
0,15... 0,34
0,98
70
-20... +55
28
A2
01
BE 224-T5-S
9620071
24W
220-240
0,16... 0,24
0,98
70
-20... +55
28
A2
01
BE 239-T5-S
9620072
39W
220-240
0,36
0,98
70
-20... +50
28
A2
01
~ Class I ballast for built-in use.
~ Ignition with preheating in cathodes for longer lamp life,
YKVJQWVƀCUJGUQTƀKEMGTKPI
`%QPUVCPVVQVCNRQYGTCPFUVCDKNK\GFNWOKPQWUƀWZ
`*KIJHTGSWGPE[QRGTCVKQP*KIJGPGTI[GHſEKGPE[
~ Corrected stroboscopic effect.
~ Allows the use of Class I and Class II luminaires without
screening to earth in the lamps.
~ Permitted input voltage 198-264V, 50-60Hz.
~ Withstands 2 hours at 350V (AC).
`4CRKFEQPPGEVKQPEQPPGEVQTYKVJſZKPIURTKPI%KTEWNCTEQPFWEVQT
section: 0,5-1,5 mm2 .
~ Balasto a incorporar Clase I.
~ Encendido con precalentamiento de cátodos para una larga vida
de la lámpara, sin destellos, ni parpadeos.
`2QVGPEKCVQVCNEQPUVCPVG[ƀWLQNWOKPQUQGUVCDKNK\CFQ
`(WPEKQPCOKGPVQGPCNVCHTGEWGPEKC#NVCGſEKGPEKCGPGTIÃVKEC
~ Efecto estroboscópico corregido.
~ Permite el uso en luminarias de Clase I y Clase II sin
apantallamiento a tierra de las lámparas.
~ Tensión permitida 198-264V, 50-60Hz
~ Soporta 2 horas a 350V (AC).
`%QPGEVQTGUFGEQPGZKÎPT¶RKFCEQPOWGNNGFGſLCEKÎP
Sección del conductor circular: 0,5-1,5 mm2 .
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
2TQFWEVUGNGEVKQPRCICPFYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
Instructions manual on www.elt.es/productos/inst_manual.html
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
Selección de producto pág. 124 y www.elt.es/productos/buscador_producto.html
Manual de instrucciones en www.elt.es/productos/manual_instrucciones.html
1 LAMP
1
2
3
4
LAMP
Tc (ºC)
80
EN 61347-1-2-3 Safety / Seguridad
EN 60929 Performance / Funcionamiento
EN 61000-3-2 Harmonics / Armónicos
EN 55015 Interferences / Interferencias
EN 61547 EMC Immunity / Inmunidad CEM
www.elt.es
2 LAMPS
Tc max = 70 ºC
70
60
5
6
7
20
40
60
80
107
100
x1000 h. Lifetime
1
2
3
4
LAMP
LAMP
BE-T5-S
220-240V
50-60Hz
BE-T5-S-UN
110-240V
50-60Hz
(OHFWURQLF683(56/,0EDOODVWVIRURUÀXRUHVFHQWODPSV
7+(DQG7+2XQLYHUVDOYROWDJH9
%DODVWRVHOHFWUyQLFRV683(56/,0SDUDROiPSDUDVÀXRUHVFHQWHV
7+(\7+2WHQVLyQXQLYHUVDO9
5
312
7
24
21
4,5
8,5
4,25
5
5
314
324
.#/2$#..#565$#.#56152#4#./2#4#
Model
Voltage AC
Power
Power
factor
Max.temp.
at tc point
Operating
temp.
Factor
de
potencia
Temp.máx.
envolvente
Temp.
funcionamiento
Current
Units
per box
Index
Ref. No.
Potencia
Tensión AC
50-60Hz
W
V ± 10%
(A)
NJ
tc (°C)
ta (°C)
BE 114-35-T5-S-UN
9610036
9
110-240
0,97
70
-25... +55
A2
BE 124-T5-S-UN
9610037
24W
110-240
0,25
0,97
70
-25... +55
A2
BE 139-T5-S-UN
39W
110-240
0,40
0,97
70
-25... +55
A2
0,15… 0,34
70
-25... +55
A2
Modelo
Intensidad
Unidades
RQTECLC
Índice
EEI
.#/25$#..#565$#.#56152#4#./2#4#5
BE 214-21-T5-S-UN
9620073
Z9
110-240
~ Class I ballast for built-in use.
~ Ignition with preheating in cathodes for longer lamp life,
YKVJQWVƀCUJGUQTƀKEMGTKPI
`%QPUVCPVVQVCNRQYGTCPFUVCDKNK\GFNWOKPQWUƀWZ
`*KIJHTGSWGPE[QRGTCVKQP*KIJGPGTI[GHſEKGPE[
~ Corrected stroboscopic effect.
~ Allows the use of Class I and Class II luminaires without
screening to earth in the lamps.
~ Permitted input voltage AC: 99-264V.
~ Withstands 2 hours at 350V (AC).
`4CRKFEQPPGEVQTYKVJſZKPIURTKPIUGEVKQPOO2 .
~ Balasto a incorporar Clase I.
~ Encendido con precalentamiento de cátodos para una larga vida
de la lámpara, sin destellos, ni parpadeos.
`2QVGPEKCVQVCNEQPUVCPVG[ƀWLQNWOKPQUQGUVCDKNK\CFQ
`(WPEKQPCOKGPVQGPCNVCHTGEWGPEKC#NVCGſEKGPEKCGPGTIÃVKEC
`'HGEVQGUVTQDQUEÎRKEQEQTTGIKFQ
~ Permite el uso en luminarias de Clase I y Clase II sin
apantallamiento a tierra de las lámparas.
~ Tensión permitida AC: 99-264V.
~ Soporta 2 horas a 350V (AC).
`%QPGEVQTGUFGEQPGZKÎPT¶RKFCEQPOWGNNGFGſLCEKÎP
Sección del conductor circular: 0,5-1,5 mm2 .
2CEMCIKPICPFYGKIJVRCICPFYYYGNVGURTQFWEVQURCEMCIKPIA'.6RFH
2TQFWEVUGNGEVKQPRCICPFYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
+PUVTWEVKQPUOCPWCNQPYYYGNVGURTQFWEVQUKPUVAOCPWCNJVON
'ODCNCLG[RGUQR¶I[YYYGNVGURTQFWEVQUGODCNCLGA'.6RFH
5GNGEEKÎPFGRTQFWEVQR¶I[YYYGNVGURTQFWEVQUDWUECFQTARTQFWEVQJVON
/CPWCNFGKPUVTWEEKQPGUGPYYYGNVGURTQFWEVQUOCPWCNAKPUVTWEEKQPGUJVON
1 LAMP
1
2
3
4
Tc (ºC)
80
EN 61347-1-2-3 Safety / Seguridad
EN 60929 Performance / Funcionamiento
EN 61000-3-2 Harmonics / Armónicos
EN 55015 Interferences / Interferencias
EN 61547 EMC Immunity / Inmunidad CEM
LAMP
2 LAMPS
Tc max = 70 ºC
70
5
6
7
60
1
2
3
4
LAMP
LAMP
20
40
60
80
108
100
x1000 h. Lifetime
www.elt.es
(OHFWURQLFEDOODVWVIRURUÀXRUHVFHQWODPSV7+(:
%DODVWRVHOHFWUyQLFRVSDUDROiPSDUDVÀXRUHVFHQWHV
de 14W T5-HE
BE-T5-2
220-240V
50-60Hz
40
28
4,25
5
5
220
230
3 AND 4 LAMPS BALLASTS / BALASTOS PARA 3 Y 4 LÁMPARAS
Model
Modelo
Ref. No.
Power
factor
Max.temp.
CVVERQKPV
1RGTCVKPI
temp.
Factor de
potencia
Temp.máx.
envolvente
Temp.
funcionamiento
(A)
NJ
tc (°C)
ta (°C)
0,21... 0,285
0,97
70
-20... +55
Power
Current
Potencia
Intensidad
W
BE 414-T5-2
9640005
T5-HE
3x 4x 14W
7PKVURGT Index
DQZ
Índice
Unidades
por caja
Approvals
Homologaciones
EEI
24
A2
01
~ Class I ballast for built-in use.
~ Ignition with preheating in cathodes for a long life in the lamp,
YKVJQWVƀCUJGUQTƀKEMGTKPI
`%QPUVCPVVQVCNRQYGTCPFUVCDKNK\GFNWOKPQWUƀWZ
`*KIJHTGSWGPE[QRGTCVKQP*KIJGPGTI[GHſEKGPE[
~ Corrected stroboscopic effect.
~ Allows the use of Class I and Class II luminaires without
screening to earth in the lamps.
~ Permitted input voltage 198-264V, 50-60Hz.
~ Withstands 2 hours at 350V (A/C).
`4CRKFEQPPGEVKQPEQPPGEVQTYKVJſZKPIURTKPI
Circular conductor section: 0,5-1,5 mm2 .
~ Connection terminals for automatic luminaire wiring (ALF
connections) available upon request.
~ Balasto a incorporar Clase I.
~ Encendido con precalentamiento de cátodos para una larga vida
de la lámpara, sin destellos, ni parpadeos.
`2QVGPEKCVQVCNEQPUVCPVG[ƀWLQNWOKPQUQGUVCDKNK\CFQ
`(WPEKQPCOKGPVQGPCNVCHTGEWGPEKC#NVCGſEKGPEKCGPGTIÃVKEC
~ Efecto estroboscópico corregido.
~ Permite el uso en luminarias de Clase I y Clase II sin
apantallamiento a tierra de las lámparas.
~ Tensión permitida 198-264V, 50-60Hz.
~ Soporta 2 horas a 350V (A/C).
`%QPGEVQTGUFGEQPGZKÎPT¶RKFCEQPOWGNNGFGſLCEKÎP
Sección del conductor circular: 0,5-1,5 mm2 .
~ Disponible bajo pedido con bornes para cableado automático de
luminarias sistema (ALF).
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
2TQFWEVUGNGEVKQPRCICPFYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
Instructions manual on www.elt.es/productos/inst_manual.html
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
Selección de producto pág. 124 y www.elt.es/productos/buscador_producto.html
Manual de instrucciones en www.elt.es/productos/manual_instrucciones.html
3 LAMPS
7
8
9
10
1
LAMP
2
3
LAMP
4
5
LAMP
Tc (ºC)
80
EN 61347-2-3 Safety / Seguridad
EN 60929 Performance / Funcionamiento
EN 61000-3-2 Harmonics / Armónicos
EN 55015 Interferences / Interferencias
EN 61547 EMC Immunity / Inmunidad CEM
www.elt.es
6
4 LAMPS
Tc max = 70 ºC
70
7
8
9
10
60
LAMP
LAMP
LAMP
20
40
60
80
109
100
x1000 h. Lifetime
LAMP
1
2
3
4
5
6
BE-T5-4-UN
110-240V
DC/AC 50-60Hz
(OHFWURQLFEDOODVWVIRURUÀXRUHVFHQWODPSV7+(:
Universal voltage 110-240V
%DODVWRVHOHFWUyQLFRVSDUDROiPSDUDVÀXRUHVFHQWHV
de 14W T5-HE. Tensión universal 110-240V
40
28
4,25
5
5
220
230
3 AND 4 LAMPS BALLASTS / BALASTOS PARA 3 Y 4 LAMPARAS
Model
Modelo
Voltage
DC/AC
Power
Ref. No.
Tensión
DC/AC
50-60Hz
Potencia
W
BE 414-T5-4-UN
9640021
T5-HE
Current
3x 4x 14W
Intensidad
Power
factor
Max.temp.
CVVERQKPV
1RGTCVKPI
temp.
Factor de
potencia
Temp.máx.
envolvente
Temp.
funcionamiento
V
(A)
NJ
tc (°C)
ta (°C)
110-240
0,70… 0,28
0,97
70
-20... +55
7PKVURGT
DQZ
Unidades
por caja
Index
Índice
EEI
24
A2
~ Class I ballast for built-in use.
~ Ignition with preheating in cathodes for a long life in the lamp,
YKVJQWVƀCUJGUQTƀKEMGTKPI
`%QPUVCPVVQVCNRQYGTCPFUVCDKNK\GFNWOKPQWUƀWZ
`*KIJHTGSWGPE[QRGTCVKQP*KIJGPGTI[GHſEKGPE[
~ Corrected stroboscopic effect.
~ Allows the use of Class I and Class II luminaires without
screening to earth in the lamps.
~ Permitted input voltage AC/DC: 99-264V.
~ Withstands 2 hours at 350V (A/C).
`4CRKFEQPPGEVKQPEQPPGEVQTYKVJſZKPIURTKPI
Circular conductor section: 0,5-1,5 mm2 .
~ Anti-reverse polarity protection.
~ Connection terminals for automatic luminaire wiring (ALF
connections) available upon request.
~ Balasto a incorporar Clase I.
~ Encendido con precalentamiento de cátodos para una larga vida
de la lámpara, sin destellos, ni parpadeos.
`2QVGPEKCVQVCNEQPUVCPVG[ƀWLQNWOKPQUQGUVCDKNK\CFQ
`(WPEKQPCOKGPVQGPCNVCHTGEWGPEKC#NVCGſEKGPEKCGPGTIÃVKEC
~ Efecto estroboscópico corregido.
~ Permite el uso en luminarias de Clase I y Clase II sin
apantallamiento a tierra de las lámparas.
~ Tensión permitida AC/DC: 99-264V.
~ Soporta 2 horas a 350V (A/C).
`%QPGEVQTGUFGEQPGZKÎPT¶RKFCEQPOWGNNGFGſLCEKÎP
Sección del conductor circular: 0,5-1,5 mm2 .
~ Protección contra inversión de polaridad.
~ Disponible bajo pedido con bornes para cableado automático de
luminarias sistema (ALF).
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
2TQFWEVUGNGEVKQPRCICPFYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
Instructions manual on www.elt.es/productos/inst_manual.html
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
Selección de producto pág. 124 y www.elt.es/productos/buscador_producto.html
Manual de instrucciones en www.elt.es/productos/manual_instrucciones.html
3 LAMPS
7
8
9
10
LAMP
LAMP
1
2
3
4
LAMP
Tc (ºC)
80
EN 61347-2-3 Safety / Seguridad
EN 60929 Performance / Funcionamiento
EN 61000-3-2 Harmonics / Armónicos
EN 55015 Interferences / Interferencias
EN 61547 EMC Immunity / Inmunidad CEM
5
6
4 LAMPS
Tc max = 70 ºC
70
7
8
9
10
60
LAMP
LAMP
LAMP
20
40
60
80
110
100
x1000 h. Lifetime
LAMP
1
2
3
4
5
6
www.elt.es
(OHFWURQLFEDOODVWVIRU7+2ÀXRUHVFHQWODPSV
%DODVWRVHOHFWUyQLFRVSDUDOiPSDUDVÀXRUHVFHQWHV7+2
5
348
BE-T5
220-240V
50-60Hz
30
7
21
4,5
10
4,25
5
Format 1
Formato 1
5
350
360
40
28
4,25
5
Format 2
Formato 2
5
350
360
2 LAMPS BALLASTS / BALASTOS PARA 2 LAMPARAS
Power
factor
Max.temp.
at tc point
Operating
temp.
Factor de
potencia
Temp.máx.
envolvente
Temp.
funcionamiento
(A)
NJ
tc (°C)
ta (°C)
0,46
0,97
70
-20... +50
1
16
A2
-
0,50
0,97
70
-20... +50
1
16
A2
-
0,77
0,98
70
-20... +50
2
18
A2
Power
Current
Ref. No.
Potencia
Intensidad
W
BE 249-T5
9620008
49W
BE 254-T5
9620009
54W
9620016
80W
Model
Modelo
(1)
BE 280-T5
Format
Units
per box
Formato Unidades
por caja
Index
Índice
Approvals
Homologaciones
EEI
01
~ Class I ballast for built-in use.
~ Ignition with preheating in cathodes for a long life in the lamp,
YKVJQWVƀCUJGUQTƀKEMGTKPI
`%QPUVCPVVQVCNRQYGTCPFUVCDKNK\GFNWOKPQWUƀWZ
`*KIJHTGSWGPE[QRGTCVKQP*KIJGPGTI[GHſEKGPE[
~ Corrected stroboscopic effect.
~ Allows the use of Class I and Class II luminaires without
screening to earth in the lamps.
~ Permitted input voltage 198-264V, 50-60Hz.
~ Withstands 2 hours at 350V (A/C).
`4CRKFEQPPGEVKQPEQPPGEVQTYKVJſZKPIURTKPI
Circular conductor section: 0,5-1,5 mm2 .
~ Balasto a incorporar Clase I.
~ Encendido con precalentamiento de cátodos para una larga vida
de la lámpara, sin destellos, ni parpadeos.
`2QVGPEKCVQVCNEQPUVCPVG[ƀWLQNWOKPQUQGUVCDKNK\CFQ
`(WPEKQPCOKGPVQGPCNVCHTGEWGPEKC#NVCGſEKGPEKCGPGTIÃVKEC
`'HGEVQGUVTQDQUEÎRKEQEQTTGIKFQ
~ Permite el uso en luminarias de Clase I y Clase II sin
apantallamiento a tierra de las lámparas.
`6GPUKÎPRGTOKVKFC8*\
~ Soporta 2 horas a 350V (A/C).
`%QPGEVQTGUFGEQPGZKÎPT¶RKFCEQPOWGNNGFGſLCEKÎP
Sección del conductor circular: 0,5-1,5 mm2 .
(1) Permitted input voltage 198-254V.
(1) Tensión permitida 198-254V.
2CEMCIKPICPFYGKIJVRCICPFYYYGNVGURTQFWEVQURCEMCIKPIA'.6RFH
2TQFWEVUGNGEVKQPRCICPFYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
+PUVTWEVKQPUOCPWCNQPYYYGNVGURTQFWEVQUKPUVAOCPWCNJVON
'ODCNCLG[RGUQR¶I[YYYGNVGURTQFWEVQUGODCNCLGA'.6RFH
5GNGEEKÎPFGRTQFWEVQR¶I[YYYGNVGURTQFWEVQUDWUECFQTARTQFWEVQJVON
/CPWCNFGKPUVTWEEKQPGUGPYYYGNVGURTQFWEVQUOCPWCNAKPUVTWEEKQPGUJVON
49-54W
1
2
3
4
5
6
7
Tc (ºC)
80
EN 61347-2-3 Safety / Seguridad
EN 60929 Performance / Funcionamiento
EN 61000-3-2 Harmonics / Armónicos
EN 55015 Interferences / Interferencias
EN 61547 EMC Immunity / Inmunidad CEM
www.elt.es
LAMP
LAMP
80W
Tc max = 70 ºC
70
60
20
40
60
80
111
100
x1000 h. Lifetime
1
2
3
4
5
6
7
8
LAMP
LAMP
(OHFWURQLFEDOODVWVIRURUÀXRUHVFHQWODPSV7+2:
%DODVWRVHOHFWUyQLFRVSDUDROiPSDUDVÀXRUHVFHQWHV
de 24W T5-HO
40
28
4,25
5
Format 1
Formato 1
5
220
230
40
28
4,25
5
5
350
Format 2
Formato 2
360
Model
Modelo
Power
Ref.
No.
Intensidad
Potencia
W
BE 324-T5-2
T8
9630008 TC-L
TC-L
T5-HO
Power
factor
Current
18
18
24
24(*)
Factor
de
potencia
Max.temp.
CVVERQKPV
1RGTCVKPI
temp.
Format
Temp.máx.
Temp.
envolvente funcionamiento Formato
7PKVURGT
DQZ
Unidades
por caja
Index
Índice
EEI
Homologaciones
3 LAMPS BALLASTS / BALASTOS PARA 3 LAMPARAS
Approvals
BE-T5-2
220-240V
50-60Hz
(A)
NJ
tc (°C)
ta (°C)
0,355
0,97
70
-20... +55
1
24
A2
(*)
01
70
-20... +55
2
18
A2
(*)
01
3 OR 4 LAMPS BALLASTS / BALASTOS PARA 3 O 4 LAMPARAS
BE 424-T5-2
9640009
T5-HO
TC-L
T8
TC-L
3x 4x 24 (*)
3x 4x
24 0,270... 0,490
3x 4x
18
3x 4x
18
0,97
~ Class I ballasts for built-in use.
~ Ignition with preheating in cathodes for a long life in the lamp,
YKVJQWVƀCUJGUQTƀKEMGTKPI
`%QPUVCPVVQVCNRQYGTCPFUVCDKNK\GFNWOKPQWUƀWZ
~ High frequency operation. High energy effciency.
~ Corrected stroboscopic effect.
~ Allows the use of Class I and Class II luminaires without
screening to earth in the lamps.
~ Permitted input voltage 198-254V, 50-60Hz.
~ Withstands 2 hours at 350V (A/C).
`4CRKFEQPPGEVKQPEQPPGEVQTYKVJſZKPIURTKPI%KTEWNCTEQPFWEVQT
section: 0,5-1,5 mm2 .
~ Connections terminal for automatic luminaire wiring (ALF
connections) available upon request.
~ Balasto a incorporar Clase I.
~ Encendido con precalentamiento de cátodos para una larga vida
de la lámpara, sin destellos ni parpadeos.
`2QVGPEKCVQVCNEQPUVCPVG[ƀWLQNWOKPQUQGUVCDKNK\CFQ
`(WPEKQPCOKGPVQGPCNVCHTGEWGPEKC#NVCGſEKGPEKCGPGTIÃVKEC
~ Efecto estroboscópico corregido.
~ Permite el uso en luminarias de Clase I y Clase II sin
apantallamiento a tierra de las lámparas.
~ Tensión permitida 198-254V, 50-60Hz.
~ Soporta 2 horas a 350V (A/C).
`%QPGEVQTGUFGEQPGZKÎPT¶RKFCEQPOWGNNGFGſLCEKÎP5GEEKÎP
del conductor circular: 0,5-1,5 mm2 .
~ Disponible bajo pedido con bornes para cableado automático de
luminarias sistema (ALF).
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
2TQFWEVUGNGEVKQPRCICPFYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
Instructions manual on www.elt.es/productos/inst_manual.html
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
Selección de producto pág. 124 y www.elt.es/productos/buscador_producto.html
Manual de instrucciones en www.elt.es/productos/manual_instrucciones.html
BE 324-T5-2
3 LAMPS
7
8
9
10
LAMP
BE 424-T5-2
3 LAMPS
1
3
LAMP
LAMP
LAMP
2
4
5
12
11
10
9
LAMP
6
Tc (ºC)
80
EN 61347-2-3 Safety / Seguridad
EN 60929 Performance / Funcionamiento
EN 61000-3-2 Harmonics / Armónicos
EN 55015 Interferences / Interferencias
EN 61547 EMC Immunity / Inmunidad CEM
LAMP
1
2
3
4
5
6
7
8
BE 424-T5-2
4 LAMPS
Tc max = 70 ºC
70
LAMP
12
11
10
9
60
20
40
60
80
112
100
x1000 h. Lifetime
LAMP
LAMP
LAMP
1
2
3
4
5
6
7
8
www.elt.es
BE-UV
220-240
50-60Hz
Electronic ballasts for 2 T5-HO – UV – Disinfection applications for
ÀXRUHVFHQWODPSV
$CNCUVQUGNGEVTÎPKEQURCTCN¶ORCTCUƀWQTGUEGPVGU6*1Ō78#Ō
Aplicaciones de desinfección
40
28
4,25
5
5
350
360
2 LAMPS BALLASTS / BALASTOS PARA 2 LAMPARAS
Model
Modelo
Ref. No.
Power
factor
Max.temp.
CVVERQKPV
1RGTCVKPI
temp.
7PKVURGTDQZ
Index
Factor de
potencia
Temp.máx.
envolvente
Temp.
funcionamiento
Unidades
por caja
Índice
(A)
NJ
tc (°C)
ta (°C)
0,41… 0,66
0,98
70
-20... +50
Power
Current
Potencia
Intensidad
W
BE 275-UV
9620060
T5 G36
T5 G64
2x 41W
2x 75W
EEI
18
A2
18
A2
2 LAMPS BALLASTS / BALASTOS PARA 2 LAMPARAS
INCLUDING TERMINALS FOR LED SIGNAL LAMP / INCLUYE CONEXIONES PARA SEÑALIZACION POR LED
BE 275-UV-LED
9620061
T5 G36
T5 G64
2x 41W
2x 75W
0,41… 0,66
0,98
70
-20... +50
~ Class I ballast for built-in use.
~ Ignition with preheating in cathodes for a long life in the lamp,
YKVJQWVƀCUJGUQTƀKEMGTKPI
`%QPUVCPVVQVCNRQYGTCPFUVCDKNK\GFNWOKPQWUƀWZ
`*KIJHTGSWGPE[QRGTCVKQP*KIJGPGTI[GHſEKGPE[
~ Corrected stroboscopic effect.
~ Allows the use of Class I and Class II luminaires without
screening to earth in the lamps.
~ Permitted voltage 198-254V, 50-60Hz.
~ Withstands 2 hours at 350V (A/C).
`4CRKFEQPPGEVKQPEQPPGEVQTYKVJſZKPIURTKPI%KTEWNCT
conductor section: 0,5-1,5 mm2 .
~ Connection terminals for automatic luminaire wiring (ALF
connections) available upon request.
~ BE 275-UV-LED: Suitable for applications where LED visual control
is required for a proper functioning.
~ Balasto a incorporar Clase I.
~ Encendido con precalentamiento de cátodos para una larga vida
de la lámpara, sin destellos, ni parpadeos.
`2QVGPEKCVQVCNEQPUVCPVG[ƀWLQNWOKPQUQGUVCDKNK\CFQ
`(WPEKQPCOKGPVQGPCNVCHTGEWGPEKC#NVCGſEKGPEKCGPGTIÃVKEC
~ Efecto estroboscópico corregido.
~ Permite el uso en luminarias de Clase I y Clase II sin
apantallamiento a tierra de las lámparas.
~ Tensión permitida 198-254V, 50-60Hz.
~ Soporta 2 horas a 350V (A/C).
`%QPGEVQTGUFGEQPGZKÎPT¶RKFCEQPOWGNNGFGſLCEKÎP
Sección del conductor circular: 0,5-1,5 mm2 .
~ Disponible bajo pedido con bornes para cableado automático de
luminarias sistema (ALF).
~ BE 275-UV-LED: Aplicaciones para control visual de
funcionamiento.
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
2TQFWEVUGNGEVKQPRCICPFYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
Instructions manual on www.elt.es/productos/inst_manual.html
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
Selección de producto pág. 124 y www.elt.es/productos/buscador_producto.html
Manual de instrucciones en www.elt.es/productos/manual_instrucciones.html
1
2
3
4
5
6
7
8
LAMP 41/75 UV
LAMP 41/75 UV
Power Outpout
Tc (ºC)
80
EN 61347-2-3 Safety / Seguridad
EN 60929 Performance / Funcionamiento
EN 61000-3-2 Harmonics / Armónicos
EN 55015 Interferences / Interferencias
EN 61547 EMC Immunity / Inmunidad CEM
www.elt.es
Tc max = 70 ºC
70
12
11
10
9
L
N
60
20
40
60
80
113
100
x1000 h. Lifetime
Power In-put + Signal output
BE 275-UV-LED
BE-2
220-240V
50-60Hz
(OHFWURQLFEDOODVWVIRURUÀXRUHVFHQWODPSV7
reduced length
$CNCUVQUGNGEVTÎPKEQURCTCQN¶ORCTCUƀWQTGUEGPVGU
T5 longitud reducida
40
28
4,25
5
5
220
230
1 LAMP BALLASTS / BALASTOS PARA 1 LÁMPARA
Model
Modelo
Power
Ref. No.
Potencia
W
BE 180-T5-2
9610132
T5 HO
Power
factor
Max.temp.
CVVERQKPV
1RGTCVKPI
temp.
7PKVU Index
RGTDQZ
Factor
Intensidad
Temp.máx.
Temp.
Índice
de
envolvente funcionamiento Unidades
potencia
por caja
Current
1x 80W
(A)
NJ
tc (°C)
ta (°C)
0,38
0,95
70
-20... +50
24
A2
Approvals
Homologaciones
EEI
01
1 OR 2 LAMPS BALLASTS / BALASTOS PARA 1 O 2 LÁMPARAS
BE 236-2
9620014
T5 HO
1x 2x
1x 2x
24W
39W
0,09... 0,31
0,98
70
-20... +50
24
A2
01
BE 258-2
9620013
T5 HO
1x 2x
54W
0,24... 0,48
0,98
70
-20... +50
24
A2
01
BE-214-28-T5-2
9621200
T5 HE
1x 2x 14, 21, 28W
1x
35W
0,07… 0,29
0,94
70
-20... +50
24
A2
01
~ Class I ballast for built-in use.
~ Ignition with preheating in cathodes for a long life in the lamp,
YKVJQWVƀCUJGUQTƀKEMGTKPI
`%QPUVCPVVQVCNRQYGTCPFUVCDKNK\GFNWOKPQWUƀWZ
`*KIJHTGSWGPE[QRGTCVKQP*KIJGPGTI[GHſEKGPE[
~ Corrected stroboscopic effect.
~ Allows the use of Class I and Class II luminaires without
screening to earth in the lamps.
~ Permitted input voltage 198-264V, 50-60Hz.
~ Withstands 2 hours at 350V (A/C).
`4CRKFEQPPGEVKQPEQPPGEVQTYKVJſZKPIURTKPI
Circular conductor section: 0,5-1,5 mm2 .
~ Connection terminals for automatic luminaire wiring (ALF ).
~ Balasto a incorporar Clase I.
~ Encendido con precalentamiento de cátodos para una larga vida
de la lámpara, sin destellos ni parpadeos.
`2QVGPEKCVQVCNEQPUVCPVG[ƀWLQNWOKPQUQGUVCDKNK\CFQ
`(WPEKQPCOKGPVQGPCNVCHTGEWGPEKC#NVCGſEKGPEKCGPGTIÃVKEC
~ Efecto estroboscópico corregido.
~ Permite el uso en luminarias de Clase I y Clase II sin
apantallamiento a tierra de las lámparas.
~ Tensión permitida 198-264V, 50-60Hz.
~ Soporta 2 horas a 350V (A/C).
`%QPGEVQTGUFGEQPGZKÎPT¶RKFCEQPOWGNNGFGſLCEKÎP
Sección del conductor circular: 0,5-1,5 mm2 .
~ Disponible bajo pedido con bornes para cableado automático de
luminarias sistema (ALF).
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
2TQFWEVUGNGEVKQPRCICPFYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
Instructions manual on www.elt.es/productos/inst_manual.html
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
Selección de producto pág. 124 y www.elt.es/productos/buscador_producto.html
Manual de instrucciones en www.elt.es/productos/manual_instrucciones.html
Tc (ºC)
80
EN 61347-2-3 Safety / Seguridad
EN 60929 Performance / Funcionamiento
EN 61000-3-2 Harmonics / Armónicos
EN 55015 Interferences / Interferencias
EN 61547 EMC Immunity / Inmunidad CEM
1 LAMP
Tc max = 70 ºC
70
1
2
LAMP
2 LAMPS
1
2
3
3
5
5
6
6
7
7
LAMP
60
20
40
60
80
114
100
x1000 h. Lifetime
LAMP
www.elt.es
Dimmable electronic ballasts for 1 or 2 T8 / TC-L / T5
ÀXRUHVFHQWODPSV95(*8/$7,21
%DODVWRVHOHFWUyQLFRVGLPDEOHVSDUDROiPSDUDVÀXRUHVFHQWHV
T8 / TC-L / T5. REGULACIÓN 1... 10V
30
26
360
350
5
5
1 LAMP BALLASTS / BALASTOS PARA 1 LÁMPARA
Model
Modelo
Ref. No.
Power
factor
Max.temp.
CVVERQKPV
Intensidad
Factor de
potencia
Temp.máx.
envolvente
Power
Current
Potencia
W
1RGTCVKPI
temp.
7PKVURGT Index
DQZ
Temp.
Índice
funcionamiento Unidades
por caja
(A)
NJ
tc (°C)
ta (°C)
14W
21W
28W
35W
0,074... 0,17
0,98
75
+10... +60
24
A1 BAT
Approvals
Homologaciones
EEI
DBE 114-35
9614030
T5HE
DBE 118-40
9614040
T8
TC-L
TC-F
T5-HO
18,25,36W
18,24,36,40W
18,24,36W
24,39W
0,078... 0,19
0,98
75
+0... +60
24
A1 BAT
DBE 154-58
9614050
T8
TC-L
T5-HO
58W
55W
54W
0,24... 0,25
0,98
75
+0... +60
24
A1 BAT
2 LAMPS BALLASTS / BALASTOS PARA 2 LÁMPARAS
14W
21W
28W
35W
0,013... 0,35
0,98
75
+0... +60
24
A1 BAT
T8
TC-L
TC-F
T5-HO
18,25,36W
18,24,36,40W
18,24,36W
24,39W
0,21... 0,37
0,98
75
+0... +60
24
A1 BAT
T8
TC-L
T5-HO
58W
55W
54W
0,45... 0,49
0,98
75
+0... +60
24
A1 BAT
DBE 214-35
9624030
T5HE
DBE 218-40
9624040
DBE 254-58
9624050
~ Brightness regulation by control voltage 1...10Vdc.
~ Regulation range 1...100%.
~ Class I ballast for built-in use.
~ Ignition with preheating in cathodes for a long life in the lamp,
YKVJQWVƀCUJGUQTƀKEMGTKPI
`*KIJHTGSWGPE[QRGTCVKQP*KIJGPGTI[GHſEKGPE[
~ Corrected stroboscopic effect.
~ Allows the use of Class I and Class II luminaires without screening
to earth in the lamps.
~ Permitted input voltage 180-300 Vac, 50-60Hz, 160-300Vdc.
`4CRKFEQPPGEVKQPEQPPGEVQTYKVJſZKPIURTKPI
Circular conductor section: 0,5-1,5 mm2 .
~ Anti-reverse polarity protection.
~ Control de regulación por voltaje 1… 10Vdc.
~ Rango de regulación de 1… 100%.
~ Balasto a incorporar Clase I.
~ Encendido con precalentamiento de cátodos para una larga vida de
la lámpara, sin destellos, ni parpadeos.
`(WPEKQPCOKGPVQGPCNVCHTGEWGPEKC#NVCGſEKGPEKCGPGTIÃVKEC
~ Efecto estroboscópico corregido.
~ Permite el uso en luminarias de Clase I y Clase II sin
apantallamiento a tierra de las lámparas.
~ Tensión permitida 180-300 Vac, 50-60Hz, 160-300Vdc.
`%QPGEVQTGUFGEQPGZKÎPT¶RKFCEQPOWGNNGFGſLCEKÎP
Sección del conductor circular: 0,5-1,5 mm2 .
~ Protección contra inversión de polaridad.
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
2TQFWEVUGNGEVKQPRCICPFYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
Instructions manual on www.elt.es/productos/inst_manual.html
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
Selección de producto pág. 124 y www.elt.es/productos/buscador_producto.html
Manual de instrucciones en www.elt.es/productos/manual_instrucciones.html
2 LAMPS
1 LAMP
Tc (ºC)
+
-
80
EN 61347-2-3 Safety / Seguridad
70
EN 60929 Performance / Funcionamiento
EN 61000-3-2 Harmonics / Armónicos
60
EN 55015 Interferences / Interferencias
EN 61547 EMC Immunity / Inmunidad CEM
www.elt.es
60
80
100
115
LAMP
+
-
x1000 h. Lifetime
1
CONTROL 7
1-10Vdc
6
LAMP
5
4
2
N
L
40
4
3
Tc max = 75 ºC
20
CONTROL
1-10Vdc
N
L
3
2
1
LAMP
DBE
1... 10V
220-240V
DC/AC 50-60Hz
30
21
360
350
Model
Modelo
Ref. No.
Power
Current
Potencia
Intensidad
W
Power
factor
Max.temp. at
VERQKPV
1RGTCVKPI
temp.
Factor de
potencia
Temp.máx.
envolvente
Temp.
funcionamiento
7PKVURGT
DQZ
Unidades
por caja
Index
Índice
(A)
NJ
tc (°C)
ta (°C)
14W
24W
24W
0,07
0,11
0,11
0,95
0,98
0,98
EEI
75
+10... +50
20
A1
BAT
DBE 114/24-DALI
9614062
T5-HE
T5-HO
TC-L
DBE 118-DALI
9614063
T8
TC-L
18W
18W
0,08
0,08
0,97
0,97
75
-20... +50
+10... +50
20
A1
BAT
DBE 136-DALI
9614064
T8
TC-L
36W
36W
0,16
0,16
0,98
0,98
75
-20... +50
+10... +50
20
A1
BAT
T8
70W
0,29
0,99
DBE 121/39-DALI
9614065
T5-HE
T5-HO
TC-L
21W
39W
40W
0,11
0,18
0,18
0,95
0,98
0,98
20
A1
BAT
DBE 128/54-DALI
9614066
T5-HE
T5-HO
TC-L
28W
54W
55W
0,14
0,26
0,26
0,97
0,99
0,99
75
+10... +50
20
A1
BAT
DBE 135/49/80-DALI
9614061
T5-HE
T5-HO
T5-HO
35W
49W
80W
0,17
0,24
0,37
0,95
0,98
0,99
75
+10... +50
20
A1
BAT
DBE 158-DALI
9614067
T8
58W
0,25
0,99
75
-20... +50
20
A1
BAT
Homologaciones
DC/AC 50-60Hz
'$/,GLPPDEOHHOHFWURQLFEDOODVWVIRUÀXRUHVFHQW
lamp T8 / T5 / TC-L
Balastos electrónicos dimables DALI para 1 lámpara
ÀXRUHVFHQWHV777&/
Approvals
DALI
220-240V
-10... +50
75
+10... +50
~ Dimming control by DALI interface.
~ Manual dimming by standard normally open switches.
~ Regulation range 1...100% (3 % in TCL).
~ Class I ballast for built-in use.
~ Ignition with preheating in cathodes within 0,6 sec. for a long lamp
NKHGYKVJQWVƀCUJGUQTƀKEMGTKPI
`*KIJHTGSWGPE[QRGTCVKQP*KIJGPGTI[GHſEKGPE[
~ Very low standby consumption: approximately 0,2W.
~ Corrected stroboscopic effect.
~ Cut Off technology.
`5COGNWOKPQWUƀWZYKVJ#%QT&%UWRRN[XQNVCIG
~ Permitted input voltage 198-264Vac, 50-60z, 154-276Vdc.
~ Rapid connection connector.
IDC-contact: Connection cross-section - Solid-core wire 0,5mm2 .
%QPPGEVKQPETQUUUGEVKQPƀGZKDNGEQTGYKTGOO2 .
Push-in: Connection cross-section - Solid-core wire 0,5-1mm2 .
~ Anti-reverse polarity protection.
~ Suitable for use in emergency lighting systems according to EN
50172/DIN VDE.
~ Life of 100.000 hours at allowed Tc.
~ Control de regulación mediante interfaz DALI.
~ Regulación manual con pulsador estándar.
~ Rango de regulación de 1… 100% (3% en TCL).
~ Balasto a incorporar Clase I.
~ Encendido con precaldeo de la lámpara en un tiempo de 0,6s para
una larga vida de la lámpara, sin destellos, ni parpadeos.
`(WPEKQPCOKGPVQGPCNVCHTGEWGPEKC#NVCGſEKGPEKCGPGTIÃVKEC
~ Bajo consumo en stand-by: 0,2W aproximadamente.
~ Efecto estroboscópico corregido.
~ Tecnología Cut Off.
`/KUOQƀWLQNWOKPQUQCEQTTKGPVGEQPVÈPWC%%[CNVGTPC%#
~ Tensión permitida 198-264Vac, 50-60z, 154-276Vdc.
~ Conectores de conexión rápida.
IDC-contact: Sección cable rígido 0,5mm2 UGEEKÎPECDNGƀGZKDNG
0,75mm2 .
Push-in: Sección cable rígido 0,5-1mm2 .
~ Protección contra inversión de polaridad.
~ Válido para instalaciones de alumbrado de emergencia según
EN 50172/DIN VDE 0108-100.
~ Vida media de 100.000 horas a Tc permitido.
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
2TQFWEVUGNGEVKQPRCICPFYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
Instructions manual on www.elt.es/productos/inst_manual.html
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
Selección de producto pág. 124 y www.elt.es/productos/buscador_producto.html
Manual de instrucciones en www.elt.es/productos/manual_instrucciones.html
Tc (ºC)
DAL I
110
EN 61347-2-3 Safety / Seguridad
EN 60929 Performance / Funcionamiento
EN 61000-3-2 Harmonics / Armónicos
EN 55015 Interferences / Interferencias
EN 55022 Interferences / Interferencias
EN 61547 EMC Immunity / Inmunidad CEM
7
80
Tc max = 75 ºC
1
2
leads max. 1,5m
70
leads max. 1m
60
20
40
116
60
80
100
x1000 h. Lifetime
6
7
LAMP
www.elt.es
'$/,GLPPDEOHHOHFWURQLFEDOODVWVIRUÀXRUHVFHQW
lamps T8 / T5 / TC-L
Balastos electrónicos dimables DALI para 2
OiPSDUDVÀXRUHVFHQWHV777&/
DALI
220-240V
DC/AC 50-60Hz
30
21
425
415
Model
Modelo
Ref. No.
Power
factor
Max.temp.
CVVERQKPV
1RGTCVKPI
temp.
Power
Current
Potencia
Intensidad
Factor de
potencia
W
(A)
NJ
tc (°C)
ta (°C)
Temp.máx.
Temp.
envolvente funcionamiento
7PKVURGT
DQZ
Unidades
por caja
Index
Índice
Approvals
Homologaciones
EEI
DBE 214/24-DALI
9624062
T5-HE
T5-HO
TC-L
2x 14W
2x 24W
2x 24W
0,14
0,22
0,22
0,95
0,98
0,98
75
+10... +50
20
A1
BAT
DBE 218-DALI
9624063
T8
TC-L
2x 18W
2x 18W
0,16
0,16
0,97
0,97
75
-20...+50
+10... +50
20
A1
BAT
DBE 236-DALI
9624064
T8
TC-L
2x 36W
2x 36W
0,30
0,31
0,98
0,98
75
-20... +50
+10... +50
20
A1
BAT
DBE 221/39-DALI
9624065
T5-HE
T5-HO
TC-L
2x 21W
2x 39W
2x 40W
0,21
0,36
0,56
0,95
0,98
0,98
75
+10... +50
20
A1
BAT
DBE 228/54-DALI
9624066
T5-HE
T5-HO
TC-L
2x 28W
2x 54W
2x 55W
0,27
0,51
0,51
0,97
0,99
0,99
75
+10... +50
20
A1
BAT
DBE 235/49-DALI
9624060
T5-HE
T5-HO
2x 35W
2x 49W
0,33
0,45
0,98
0,99
75
+10... +50
20
A1
BAT
DBE 235/49/80-DALI
9624061
T5-HE
T5-HO
T5-HO
2x 35W
2x 49W
2x 80W
0,34
0,46
0,74
0,95
0,97
0,99
75
+10... +50
20
A1
BAT
DBE 258-DALI
9624067
T8
2x 58W
0,47
0,99
75
-20... +50
20
A1
BAT
~ Dimming control by DALI interface.
~ Manual dimming by standard normally open switches.
~ Regulation range 1...100% (3 % in TCL).
~ Class I ballast for built-in use.
~ Ignition with preheating in cathodes within 0,6 sec. for a long lamp
NKHGYKVJQWVƀCUJGUQTƀKEMGTKPI
`*KIJHTGSWGPE[QRGTCVKQP*KIJGPGTI[GHſEKGPE[
~ Very low standby consumption: approximately 0,2W.
~ Corrected stroboscopic effect.
~ Cut Off technology.
`5COGNWOKPQWUƀWZYKVJ#%QT&%UWRRN[XQNVCIG
~ Permitted input voltage 198-264Vac, 50-60z, 154-276Vdc.
~ Rapid connection connector.
IDC-contact: Connection cross-section - Solid-core wire 0,5mm2 .
%QPPGEVKQPETQUUUGEVKQPƀGZKDNGEQTGYKTGOO2 .
Push-in: Connection cross-section - Solid-core wire 0,5-1mm2 .
~ Anti-reverse polarity protection.
~ Suitable for use in emergency lighting systems according to EN
50172/DIN VDE.
~ Life of 100.000 hours at allowed Tc.
~ Control de regulación mediante interfaz DALI.
~ Regulación manual con pulsador estándar.
~ Rango de regulación de 1… 100% (3% en TCL).
~ Balasto a incorporar Clase I.
~ Encendido con precaldeo de la lámpara en un tiempo de 0,6s para
una larga vida de la lámpara, sin destellos, ni parpadeos.
`(WPEKQPCOKGPVQGPCNVCHTGEWGPEKC#NVCGſEKGPEKCGPGTIÃVKEC
~ Bajo consumo en stand-by: 0,2W aproximadamente.
~ Efecto estroboscópico corregido.
~ Tecnología Cut Off.
`/KUOQƀWLQNWOKPQUQCEQTTKGPVGEQPVÈPWC%%[CNVGTPC%#
~ Tensión permitida 198-264Vac, 50-60z, 154-276Vdc.
~ Conectores de conexión rápida.
IDC-contact: Sección cable rígido 0,5mm2 UGEEKÎPECDNGƀGZKDNG
0,75mm2 .
Push-in: Sección cable rígido 0,5-1mm2 .
~ Protección contra inversión de polaridad.
~ Válido para instalaciones de alumbrado de emergencia según
EN 50172/DIN VDE 0108-100.
~ Vida media de 100.000 horas a Tc permitido.
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
2TQFWEVUGNGEVKQPRCICPFYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
Instructions manual on www.elt.es/productos/inst_manual.html
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
Selección de producto pág. 124 y www.elt.es/productos/buscador_producto.html
Manual de instrucciones en www.elt.es/productos/manual_instrucciones.html
Tc (ºC)
DAL I
110
EN 61347-2-3 Safety / Seguridad
EN 60929 Performance / Funcionamiento
EN 61000-3-2 Harmonics / Armónicos
EN 55015 Interferences / Interferencias
EN 55022 Interferences / Interferencias
EN 61547 EMC Immunity / Inmunidad CEM
www.elt.es
7
80
Tc max = 75 ºC
70
60
20
40
117
60
80
100
x1000 h. Lifetime
1
2
3
4
5
6
7
leads
max. 1,5m
leads
LAMP
max.
1m
LAMP
DALI
220-240V
DC/AC 50-60Hz
DALI dimmable electronic ballasts for 3 or 4
ÀXRUHVFHQWODPSV777&/
Balastos electrónicos dimables DALI para 3 o 4
OiPSDUDVÀXRUHVFHQWHV777&/
40
21
360
350
3 LAMPS BALLASTS / BALASTOS PARA 3 LÁMPARAS
Model
Modelo
Ref. No.
Power
factor
Max.temp.
CVVERQKPV
1RGTCVKPI
temp.
Power
Current
Potencia
Intensidad
Factor de
potencia
W
(A)
NJ
tc (°C)
ta (°C)
Temp.máx.
Temp.
envolvente funcionamiento
7PKVURGT Index
DQZ
Índice
Unidades
por caja
EEI
DBE 314/24-DALI
9634062
T5-HE
T5-HO
TC-L
3x 14W
3x 24W
3x 24W
0,20
0,32
0,32
0,97
0,99
0,99
75
+10...+50
20
A1
BAT
DBE 318-DALI
9634063
T8
3x 18W
0,24
0,98
75
-20...+50
20
A1
BAT
Approvals
Homologaciones
4 LAMPS BALLASTS / BALASTOS PARA 4 LÁMPARAS
DBE 414/24-DALI
9644062
T5-HE
T5-HO
TC-L
4x 14W
4x 24W
4x 24W
0,27
0,43
0,43
0,97
0,99
0,99
75
+10...+50
20
A1
BAT
DBE 418-DALI
9644063
T8
4x 18W
0,31
0,99
75
-20...+50
20
A1
BAT
~ Dimming control by DALI interface.
~ Manual dimming by standard normally open switches.
~ Regulation range 1...100% (3 % in TCL).
~ Class I ballast for built-in use.
~ Ignition with preheating in cathodes within 0,6 sec. for a long lamp
NKHGYKVJQWVƀCUJGUQTƀKEMGTKPI
`*KIJHTGSWGPE[QRGTCVKQP*KIJGPGTI[GHſEKGPE[
~ Very low standby consumption: approximately 0,5W.
~ Corrected stroboscopic effect.
~ Cut Off technology.
`5COGNWOKPQWUƀWZYKVJ#%QT&%UWRRN[XQNVCIG
~ Permitted input voltage 198-264Vac, 50-60z, 154-276Vdc.
~ Rapid connection connector.
IDC-contact: Connection cross-section - Solid-core wire 0,5mm2 .
%QPPGEVKQPETQUUUGEVKQPƀGZKDNGEQTGYKTGOO2 .
Push-in: Connection cross-section - Solid-core wire 0,5-1mm2 .
~ Anti-reverse polarity protection.
~ Suitable for use in emergency lighting systems according to EN
50172/DIN VDE.
~ Life of 100.000 hours at allowed Tc.
~ Control de regulación mediante interfaz DALI.
~ Regulación manual con pulsador estándar.
~ Rango de regulación de 1… 100% (3% en TCL).
~ Balasto a incorporar Clase I.
~ Encendido con precaldeo de la lámpara en un tiempo de 0,6s para
una larga vida de la lámpara, sin destellos, ni parpadeos.
`(WPEKQPCOKGPVQGPCNVCHTGEWGPEKC#NVCGſEKGPEKCGPGTIÃVKEC
~ Bajo consumo en stand-by: 0,5W aproximadamente.
~ Efecto estroboscópico corregido.
~ Tecnología Cut Off.
`/KUOQƀWLQNWOKPQUQCEQTTKGPVGEQPVÈPWC%%[CNVGTPC%#
~ Tensión permitida 198-264Vac, 50-60z, 154-276Vdc.
~ Conectores de conexión rápida.
IDC-contact: Sección cable rígido 0,5mm2 UGEEKÎPECDNGƀGZKDNG
0,75mm2 .
Push-in: Sección cable rígido 0,5-1mm2 .
~ Protección contra inversión de polaridad.
~ Válido para instalaciones de alumbrado de emergencia según
EN 50172/DIN VDE 0108-100.
~ Vida media de 100.000 horas a Tc permitido.
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
2TQFWEVUGNGEVKQPRCICPFYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
Instructions manual on www.elt.es/productos/inst_manual.html
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
Selección de producto pág. 124 y www.elt.es/productos/buscador_producto.html
Manual de instrucciones en www.elt.es/productos/manual_instrucciones.html
3 LAMPS
DAL I
110
EN 61347-2-3 Safety / Seguridad
EN 60929 Performance / Funcionamiento
EN 61000-3-2 Harmonics / Armónicos
EN 55015 Interferences / Interferencias
EN 55022 Interferences / Interferencias
EN 61547 EMC Immunity / Inmunidad CEM
7
Tc (ºC)
LAMP
80
Tc max = 75 ºC
LAMP
70
60
20
40
60
118
80
100
x1000 h. Lifetime
7
8
9
10
LAMP
4 LAMPS
2
3
4
5
6
7
LAMP
LAMP
7
8
9
10
LAMP
LAMP
2
3
4
5
6
7
8
9
www.elt.es
DALI
220-240V
DALI dimmable electronic ballasts for 1 or 2
7&7(7&'(7&/ÀXRUHVFHQWODPSV
Balastos electrónicos dimables DALI para 1 o 2
lámparas compactas TC-TE / TC-DE / TC-L
DC/AC 50-60Hz
33
79 67
123
129,5
1 LAMP BALLAST / BALASTO PARA 1 LÁMPARA
Model
Modelo
Ref. No.
Current
Potencia
Intensidad
W
DBE 118/57-TC-DALI
9614072
Power
factor
Power
18W
26W
32W
42W
57W
TC-DE
TC-TE
Max.temp.
CVVERQKPV
1RGTCVKPI
temp.
7PKVU
RGTDQZ
Index
Approvals
Temp.máx.
Temp.
Índice
Homologaciones
envolvente funcionamiento Unidades
por caja
tc (°C)
ta (°C)
EEI
Factor de
potencia
(A)
NJ
0,09
0,13
0,16
0,21
0,27
0,95
0,97
0,98
0,99
0,99
+10... +50
75
20
A1
BAT
0,95
0,98
0,99
0,99
+10... +50
75
20
A1
BAT
2 LAMPS BALLASTS / BALASTOS PARA 2 LÁMPARAS
DBE 218/42-TC-DALI
9624072
2x
2x
2x
2x
TC-DE
TC-TE
18W
26W
32W
42W
0,17
0,25
0,30
0,39
~ Dimming control by DALI interface.
~ Manual dimming by standard normally open switches.
~ Regulation range 3...100%.
~ Class I ballast for built-in use.
~ Ignition with preheating in cathodes within 0,6 sec. for a long lamp
NKHGYKVJQWVƀCUJGUQTƀKEMGTKPI
`*KIJHTGSWGPE[QRGTCVKQP*KIJGPGTI[GHſEKGPE[
~ Very low standby consumption: approximately 0,2W.
~ Corrected stroboscopic effect.
~ Cut Off technology.
`5COGNWOKPQWUƀWZYKVJ#%QT&%UWRRN[XQNVCIG
~ Permitted input voltage DC/AC198-264V.
`4CRKFEQPPGEVKQPEQPPGEVQTYKVJſZKPIURTKPI
Circular conductor section: 0,5-1,5 mm2 .
~ Anti-reverse polarity protection.
~ Suitable for use in emergency lighting systems according to EN
50172/DIN VDE.
~ Life of 100.000 hours at allowed Tc.
~ Control de regulación mediante interfaz DALI.
~ Regulación manual con pulsador estándar.
~ Rango de regulación de 3… 100%.
~ Balasto a incorporar Clase I.
~ Encendido con precaldeo de la lámpara en un tiempo de 0,6s para
una larga vida de la lámpara, sin destellos, ni parpadeos.
`(WPEKQPCOKGPVQGPCNVCHTGEWGPEKC#NVCGſEKGPEKCGPGTIÃVKEC
~ Bajo consumo en stand-by: 0,2W aproximadamente
~ Efecto estroboscópico corregido.
~ Tecnología Cut Off.
`/KUOQƀWLQNWOKPQUQCEQTTKGPVGEQPVÈPWC%%[CNVGTPC%#
~ Tensión permitida DC/AC198-264V.
`%QPGEVQTGUFGEQPGZKÎPT¶RKFCEQPOWGNNGFGſLCEKÎP
Sección del conductor circular: 0,5-1,5 mm2 .
~ Protección contra inversión de polaridad.
~ Válido para instalaciones de alumbrado de emergencia según
EN 50172/DIN VDE 0108-100.
~ Vida media de 100.000 horas a Tc permitido.
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
2TQFWEVUGNGEVKQPRCICPFYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
Instructions manual on www.elt.es/productos/inst_manual.html
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
Selección de producto pág. 124 y www.elt.es/productos/buscador_producto.html
Manual de instrucciones en www.elt.es/productos/manual_instrucciones.html
1 LAMP
1
mains
23
3
22
DAL I
110
EN 61347-2-3 Safety / Seguridad
EN 60929 Performance / Funcionamiento
EN 61000-3-2 Harmonics / Armónicos
EN 55015 Interferences / Interferencias
EN 55022 Interferences / Interferencias
EN 61547 EMC Immunity / Inmunidad CEM
www.elt.es
24
DA
DA
5
mains
2
21
3
23
22
4
5
7
U-out =430V
1
21
2
4
Tc (ºC)
2 LAMPS
U-out =430V
DA
DA
24
25
26
80
Tc max = 75 ºC
27
28
70
60
20
40
60
119
80
100
x1000 h. Lifetime
DALI electronic ballast: characteristics and technical information
Características de balastos electrónicos DALI e información técnica
Ŗ&KOOCDNGD[&#.+QT6QWEJ&+/HTQOVQQHVJG
TCVGFNWOKPQWUƀWZ
KP%QORCEV(NWQTGUEGPV.CORU
Ŗ4GIWNCDNGRQT&#.+Q617%*&+/EQPTCPIQFGTGIWNCEKÎP
FGN CN FGN ƀWLQ NWOKPQUQ GP N¶ORCTCU ƀWQTGUcentes compactas).
~ &#.+ KPVGTHCEG protected DALI control input against
overvoltage and polarity reversal.
~ Interfaz DALI: Los terminales de control DALI están protegidos frente a sobretensiones y cambios de polaridad.
~ 6QWEJ &+/ by using standard commercial normally
open switches. Memory function and soft starting included.
~ Touch DIM: Regulación manual con pulsador estándar
normalmente abierto. Incluye función memoria (con doble click) y encendido suave.
Ŗ 5VCDNG FKOOKPI QRGTCVKQP CNUQ KP COCNICO CPF GPGTI[
saver lamps.
Ŗ(WPEKQPCNKFCFEQORNGVCFGTGIWNCEKÎPKPENWUQGPN¶ORCTCU
de amalgama y de ahorro energético.
Ŗ #WVQOCVKE NCOR FGVGEVKQP D[ KPVGNNKIGPV OWNVKNCOR QRGTCtion.
Ŗ 4GGPEGPFKFQ CWVQO¶VKEQ FGURWÃU FG TGGORNC\CT NC N¶Opara.
Ŗ8GT[JKIJGHſEKGPE[WRVQ
Ŗ#NVCGſEKGPEKC Ŗ%GNOCGPGTI[ENCUUKſECVKQP''+#$#6
Ŗ PFKEGFG'ſEKGPEKC'PGTIÃVKEC''+#$#6
Ŗ8GT[NQYUVCPFD[EQPUWORVKQP
~ 1x, 2x lamps: approximately 0,2W.
~ 3x, 4x lamps: < 0,5 W.
Ŗ/W[DCLQEQPUWOQGPUVCPFD[
~ 1x, 2x lámparas: 0,2W aproximativamente.
~ 3x, 4x lámparas: < 0,5W.
Ŗ1RVKOK\GFFKIKVCNN[RTGJGCVUVCTVYKVJKPUGEQPFU
`9KVJQWVƀCUJGU
~ Settings with any dimmer.
~ Wide range of ambient temperatures.
Ŗ 'PEGPFKFQ EQP RTGECNFGQ FG NC N¶ORCTC GP WP VKGORQ FG
0,6 segundos:
~ Sin destellos.
~ En cualquier nivel de regulación.
~ Amplio rango de temperaturas ambientes.
Ŗ+PVGNNKIGPVVGORGTCVWTGFGRGPFGPVEWVQHHVGEJPQNQI[
YKVJ
FKOOGTUGVVKPIUCDQXGNWOKPQWUƀWZ
Ŗ6GEPQNQIÈCEWVQHHKPVGNKIGPVGFGRGPFKGPVGFGNCVGORGTCVWTC
RCTCPKXGNGUFGTGIWNCEKÎPRQTGPEKOCFGNFGNƀWLQ
luminoso)
Ŗ2GTHGEVNCORUVCTVKPIHQTCRRNKECVKQPUYKVJOQVKQPUGPUQTU
(more than 300.000 switching cycles).
Ŗ'PEGPFKFQRGTHGEVQFGNCN¶ORCTCEQPUGPUQTGUFGOQXKmiento (más de 300.000 ciclos de conmutación).
Ŗ/CZKOWONKPGXQNVCLGTCVKPIU
~198…264Vac.
~154…276Vdc (although battery voltage may drop
to 154V, ignition must take place above 198V).
Ŗ.ÈOKVGUO¶ZKOQUFGVGPUKÎPFGTGF
~198…264Vac.
~154…276Vdc (aunque la tensión de la batería pueda caer
a 154V, el encendido deber ser a más de 198V).
Ŗ5COGNWOKPQWUƀWZYKVJ#%QT&%UWRRN[XQNVCIG
Ŗ/KUOQƀWLQNWOKPQUQCEQTTKGPVGEQPVÈPWC%%[CNVGTPC%#
Ŗ 5WKVCDNG HQT WUG KP GOGTIGPE[ NKIJVKPI U[UVGOU CEEQTFKPI
VQ'0&+08&'EQPſIWTCDNGXKCUQHVYCTG
Ŗ8¶NKFQRCTCKPUVCNCEKQPGUFGCNWODTCFQFGGOGTIGPEKC
UGIÕP'0&+08&'EQPſIWTCDNGXKC
software.
Ŗ'HHGEVKXGVJGTOCNOCPCIGOGPVKPJQVNWOKPCKTGU
~Intelligent power reduction at high Tc temperatures
~Maximum temperature in any point of the case of 110°C
assured.
Ŗ2TQVGEEKÎPVÃTOKECKPVGNKIGPVGCCNVCUVGORGTCVWTCUFG6E
~ Reducción inteligente de la potencia en altas temperaturas Tc.
~ En ningún caso la temperatura en cualquier punto de la
envolvente alcanza los 110°C.
Ŗ*KIJ2QYGT(CEVQT Ŗ#NVQHCEVQTFGRQVGPEKC Ŗ.QY6QVCN*CTOQPKE&KUVQTUKQP
6*&CVOCZKOWORQYGT
<10%.
Ŗ$CLQHCEVQTFGFKUVQTUKÎPJCTOÎPKEC
6*&CO¶ZKOCECTIC
<10 %.
120
www.elt.es
Ŗ'PF1H.KHGRTQVGEVKQP
~ Automatic safety shutdown of lamps when a defect or at
end of life.
~ Automatic restart when replacing lamps.
Ŗ2TQVGEEKÎPſPFGXKFC
~ Desconexión automática de seguridad de lámparas defectuosas o agotadas.
~ Reencendido automático después de reemplazar la lámpara.
Ŗ/CZKOWOCNNQYGFKPRWVXQNVCIG
J8
Ŗ5QRQTVCJQTCUC8
#%
Ŗ.KHGQHJQWTUCVVE
HCKNWTGTCVG
Ŗ8KFCOGFKCJQTCUCVE
VCUCFGHCNNQFG
Ŗ+PFGZRTQVGEVKQP+2
Ŗ PFKEGFGRTQVGEEKÎP+2
Ŗ$WKNVKPWUGVQKPEQTRQTCVGKPVQNWOKPCKTGU
Ŗ$CNCUVQCKPEQTRQTCTGPNWOKPCTKC
Ŗ5WKVCDNGHQTNWOKPCKTGUQHRTQVGEVKQPCICKPUVGNGEVTKECNEQPtacts class I.
Ŗ#FGEWCFQRCTCNWOKPCTKCUFGRTQVGEEKÎPENCUG+
Ŗ%CDNGETQUUUGEVKQPU
~ IDC-contact (Insulation Displacement Contact):
solid wire - max. 0,5 mm2 ƀGZKDNGYKTG
max. 0,75 mm2 .
~ 2WUJKPVGTOKPCN solid wire 0,5…1,0 mm2 .
Ŗ5GEEKQPGUFGECDNGU
~ IDC (Conexión por desplazamiento del aislamiento):
max. 0,5 mm2 ƀGZKDNGYKTGOCZOO2 .
~ Conexión rápida: cable rígido 0,5…1,0 mm2 .
1VJGTHWPEVKQPU
EQPſIWTCDNGWUKPI&#.+OCIKEYK\CTF
Otras funciones EQPſIWTCDNGEQPGN&#.+OCIKE
Ŗ6QWEJ&+/.52&UGPUQT
Ŗ6QWEJ&+/.52&UGPUQT
Ŗ%QTTKFQTHWPEVKQPCNKV[
Ŗ(WPEKÎPRCUKNNQ
Ŗ2QYGTVQ.COR
Ŗ2QYGTVQ.COR
Ŗ5OCTV/QPKVQTKPI
Ŗ5OCTV/QPKVQTKPI
Sample DALI wiring diagram:
Ejemplo esquema de conexionado DALI
L3
L2
L1
N
PE
L
N PE
DA
DA
DA DA
DALI
controller
DA
DA
DA
DA
Sample Touch DIM wiring diagram:
Ejemplo esquema de conexionado por pulsador Touch DIM
DAL I
DBE ...-DALI
1
2
6
7
DBE ...-DALI
1
2
6
7
DBE ...-DALI
1
2
6
7
L1
N
PE
DA
DA
Lamp
1
2
6
7
DBE ...-DALI
1
2
6
7
DBE ...-DALI
1
2
6
7
Push
button
Lamp
DA
DA
Lamp
DA
DA
DA DA PE N L1 L2 L3
www.elt.es
DBE ...-DALI
T PE N L1
121
TOUCH
DIM
Lamp
Lamp
Lamp
BE-EN
220-240V
50-60Hz
(OHFWURQLFEDOODVWVIRURUÀXRUHVFHQWODPSV7
IP67 protection
%DODVWRVHOHFWUyQLFRVSDUDROiPSDUDVÀXRUHVFHQWHV7
proteccion IP67
Dimensiones comunes para todos los tipos
Same dimensions for all types
49
32
340
315
7
7
4,5
RED
LAMP
LAMP
Codes / Códigos
UGTKG'0
Codes / Códigos
BE-118-EN-2 9616011
Lamp holder IP 64
Portalámparas IP 64
BE-118-EN-3 9616012
012
Lamp holder IP 40
Portalámparas IP 40
BE-136-EN-2 9616021
BE-158-EN-2 9616031
BE-136-EN-3 9616022
022
032
BE-158-EN-3 9616032
BE-218-EN-2 9626011
BE-218-EN-3 9626013
013
BE-236-EN-2 9626021
BE-236-EN-3 9626022
022
BE-258-EN-2 9626031
BE-258-EN-3 9626032
UGTKG'0
1 LAMP BALLASTS / BALASTOS PARA 1 LÁMPARA
Power
Model
Modelo
BE-118-EN
BE-136-EN
BE-158-EN
Ref. No.
9616010
9616020
9616030
Power factor
Current
Max.temp.
CVVERQKPV
1RGTCVKPIVGOR
&KOGPUKQPU
Index
7PKVURGT
DQZ
Índice
Potencia
Intensidad
Factor de
potencia
W
(A)
NJ
tc (°C)
ta (°C)
RED/NET
Mangueras
(3x0,75 mm2)
(mm)
LAMP
Cables
(2x0,50mm2)
(mm)
0,090
0,95
70
-20... +50
500
730
960
12
A2
500
730
960
12
A2
500
730
960
12
A2
1.285
760
1.350
8
A2
1.285
1.350
1.570
8
A2
1.285
1.570
2.060
8
A2
T8
T8
T8
18W
36W
58W
0,165
Temp.máx.
envolvente
0,95
0,250
Temp.
funcionamiento
70
0,95
-20... +50
70
-20... +50
Dimensiones
Unidades
por caja
EEI
2 LAMPS BALLASTS / BALASTOS PARA 2 LÁMPARAS
BE-218-EN
BE-236-EN
BE-258-EN
9626010
9626020
9626030
T8
T8
T8
18W
36W
58W
0,185
0,95
0,330
70
0,96
0,460
-20... +50
70
0,96
-20... +50
70
-20... +50
~ Balastos para incorporar en rótulos luminosos (atmósferas agresivas,
ambientes salinos y rurales, industria pesada, etc.).
~ Encendido con precalentamiento de cátodos para una larga
vida de la lámpara, sin destellos, ni parpadeos.
`2QVGPEKCVQVCNEQPUVCPVG[ƀWLQNWOKPQUQGUVCDKNK\CFQ
`(WPEKQPCOKGPVQGPCNVCHTGEWGPEKC#NVCGſEKGPEKCGPGTIÃVKEC
~ Efecto estroboscópico corregido.
~ Permite el uso en luminarias de Clase I y Clase II sin apantallamiento a tierra
de las lámparas.
~ Tensión permitida 198-264V, 50-60Hz.
~ Soporta 2 horas a 350V (A/C).
~ Previstas con salidas de cables manguera para red y lámparas
~ Se pueden suministrar con portalámparas IP-64 o conector enchufable IP40.
~ Para pedir los equipos con portalámparas, cambiar el
tipo BE...-EN por BE...-EN-2. o BE...-EN-3.
~ Incorpora reactancia ENEC.
~ No instalar nunca los cables hacia arriba.
~ Balasto electrónico compatible con el sistema de protección contra rayos e
impulsos en la entrada ITP pág. 90 y
www.elt.es\productos pdf\701000000.pdf.
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
Selección de producto pág. 124 y www.elt.es/productos/buscador_producto.html
Manual de instrucciones en www.elt.es/productos/manual_instrucciones.html
~ Ballast for built-in use in illuminated signs
(aggressive atmospheres, saline and rural environments,
heavy industry, etc.)
~ Ignition with preheating in cathodes for a long life in the lamp,
YKVJQWVƀCUJGUQTƀKEMGTKPI
`%QPUVCPVVQVCNRQYGTCPFUVCDKNK\GFNWOKPQWUƀWZ
`*KIJHTGSWGPE[QRGTCVKQP*KIJGPGTI[GHſEKGPE[
~ Corrected stroboscopic effect.
~ Allows the use of Class I and Class II luminaires without
screening to earth in the lamps.
~ Permitted input voltage 198-264V, 50-60Hz.
~ Withstands 2 hours at 350v (A/C).
~ Supplied with hose wire outlets to mains and lamps.
~ Can be supplied with lamp holder IP-64 or IP40 connector.
~ Available also with lamp holders in this case the
denomination varies BE...-EN instead of BE...-EN-2 or BE...EN-3
~ ENEC Ballast inside.
~ Never install wires upwards.
~ Input transient, surge and strike protection device ITP is suitable for this driver
pag. 90 and www.elt.es\productos\pdf\701000000.pdf.
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
2TQFWEVUGNGEVKQPRCICPFYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
Instructions manual on www.elt.es/productos/inst_manual.html
1 LAMP
N
F
Tc (ºC)
80
EN 61347-2-3 Safety / Seguridad
EN 60929 Performance / Funcionamiento
EN 61000-3-2 Harmonics / Armónicos
EN 55015 Interferences / Interferencias
EN 61547 EMC Immunity / Inmunidad CEM
Amar-Verde / Yellow-Green
Azul / Blue
Negro / Black
Lamp
2 LAMPS
Tc max = 70 ºC
70
Lamp 1
Lamp 1
60
N
F
Amar-Verde / Yellow-Green
Azul / Blue
Negro / Black
Lamp 2
20
40
60
80
122
100
x1000 h. Lifetime
Lamp 2
www.elt.es
'&(OHFWURQLFEDOODVWVIRURUÀXRUHVFHQWODPSV
%DODVWRVHOHFWUyQLFRVSDUDROiPSDUDVÀXRUHVFHQWHV
alimentados en corriente continua
CE-1
D.C.
47
64
57
100
22
22
100
244
Model
Power
Max.temp.
CVVERQKPV
7PKVURGT
DQZ
5QEMGV
0QOKPCNXQNVCIG
Voltage range
Tipo de lámpara
Casquillo de
lámpara
Tensión nominal
Tensión de rango
Temp.máx.
envolvente
Lamp type
Ref. No.
Potencia
(Vd/c)
(Vd/c)
tc (°C)
CE1 4/01
9410020
1x 18, 20, 36, 40W
2x
18, 20W
T8, T12 o/or Fa6
G13 o/or Fa6
12
9... 15
70 (1)
10
CE1 4/02
9410030
1x 18, 20, 36, 40W
2x
18, 20W
T8, T12 o/or Fa6
G13 o/or Fa6
24
18... 32
70 (1)
10
CE1 4/04
9410040
1x 18, 20, 36, 40W
2x
18, 20W
T8, T12 o/or Fa6
G13 o/or Fa6
48
33... 59
70 (1)
10
CE1 4/07
9410050
1x 18, 20, 36, 40W
2x
18, 20W
T8, T12 o/or Fa6
G13 o/or Fa6
72
50... 87
70 (1)
10
CE1 4/11
9410060
1x 18, 20, 36, 40W
2x
18, 20W
T8, T12 o/or Fa6
G13 o/or Fa6
110
75... 135
70 (1)
10
Modelo
W
(1)
/GCUWTGFHTQOVJGIGQOGVTKEEGPVTGQHDCUG
(1)
Unidades
por caja
Medida en el centro geómetrico de la base
~ Ballasts for buit-in use. Class I.
~ For operation on D.C. supplies.
~ Aluminium casing. With fast-on terminals 6,3 x 0,8 mm.
~ Protected against polarity inversion and short - circuit.
~ Withstands 1 minute possible overloads up to 30%.
~ Operation frequencies:
Empty load > 18 kHz. With load >24 kHz.
~ Applications: Trains, buses, boats, caravans, solar energy, etc.
~ Convertidores para incorporar en luminarias o pantallas.
~ Para alimentación en corriente continua.
~ Envolvente de aluminio y conexiones por terminales faston de
6,3 x 0,8 mm.
~ Protegidos contra inversión en polaridad, cortocircuitos y circuito
abierto.
~ Soportan sobretensiones de hasta el 30% durante 1 minuto.
~ Frecuencias de funcionamiento:
'PXCEÈQ M*\'PECTIC M*\
~ Aplicaciones: Ferrocarriles, autobuses, embarcaciones,
caravanas, energía solar, etc.
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
1 x 18 o 20W
1 x 36 o 40W
1
2
3
4
5
6
Tc (ºC)
80
2 x 18 o 20W
Tc max = 70 ºC
70
60
EN 60924-5 Performance / Funcionamiento
www.elt.es
20
40
60
123
80
100
x1000 h. Lifetime
124
www.elt.es
TC-D/E
G24q
TC-L
TC-F
2G11
T5HO
G5
T5HE G5
T8
G13
Lámpara
Lamp
1X
1500
51w
DBE 118/57-TC-DALI
26W
BE 226-TC-5
BE 213-TC-5
BE 218-TC-5
DBE 118/57-TC-DALI
BE 180-T5-S
18W
80w
13W
DBE 154-58
BE 226-TC-5-C2
BE 218-TC-5-C2
BE 213-TC-5-C2
DBE 118-40 DBE 118/57-TC-DALI
BE 158-2
BE 258-2
40w
55W
BE 226-TC-5-C2
BE 242-TC-5-C2
BE 226-TC-5
BE 242-TC-5
BE 226-TC-5-C2
BE 242-TC-5-C2
BE 226-TC-5-C2
BE 242-TC-5-C2
CII
32x70,2x170,5
BE-TC-5-C2
DBE 118-40
36W
BE 226-TC-5
BE 242-TC-5
BE 226-TC-5
BE 242-TC-5
29,5x69x108
BE-TC-5
BE 226-TC-5-C2
BE 242-TC-5-C2
DBE 135/49/80-DALI
DBE 128/54-DALI
DBE 135/49/80-DALI
DBE 121/39-DALI
DBE 114/24-DALI
DBE 135/49/80-DALI
DBE 128/54-DALI
DBE 121/39-DALI
DBE 114/24-DALI
DBE 158-DALI
DBE 136-DALI
DBE 118-DALI
21x30x360
33x79x123
DALI
DBE-DALI
BE 226-TC-5
BE 242-TC-5
BE 136-2
BE 236-2
BE 136-4-UN
BE 236-4-UN
DBE 118-40
24W
DBE 154-58
DBE 118-40
BE 154-T5-EN
DBE 118-40
DBE 118-40
BE 136-2
BE 236-2
BE 180-T5-S
BE 154-T5-S
BE 149-T5-EN
BE 139-T5-EN
BE 124-T5-EN
DBE 114-35
DBE 114-35
DBE 114-35
DBE 114-35
DBE 154-58
DBE 154-58
DBE 118-40
DBE 118-40
DBE 118-40
DBE 118-40
DBE 118-40
DBE 118-40
DBE 118-40
DBE 118-40
DBE 118-40
1… 10V
26x30x360
DBE
BE 136-2
BE 236-2
BE-158-UN-277V
BE 149-T5-S
BE 139-T5-S
BE 124-T5-S
BE 158-EN
BE 158-EN
BE 136-EN
BE 136-EN
BE 118-EN
BE 118-EN
BE 118-EN
IP67
32x49x340
BE-EN
18W
80W
54W
BE 158-2
BE 258-2
BE 139-T5-S-UN
39W
49W
BE 124-T5-S-UN
BE 136-2
BE 236-2
BE 114-35-T5-S
35W
BE 136-2
BE 236-2
BE-214-28-UN-277V BE 114-35-T5-S
28W
24W
BE 114-21-T5-S-UN BE-214-28-UN-277V BE 114-35-T5-S
BE-158-UN-277V
BE-158-UN-277V
BE-236-UN-277V
BE 149-T5-S
BE 114-21-T5-S-UN BE-214-28-UN-277V BE 114-35-T5-S
BE 170-3-A
BE 158-4-UN
BE 158-4-UN
BE 158-3
BE 258-3
BE 158-2
BE 258-2
BE 158-3
BE 258-3
BE 136-4-UN
BE 236-4-UN
BE 136-3
BE 236-3
BE 136-2
BE 236-2
BE 158-2
BE 258-2
BE 136-4-UN
BE 236-4-UN
BE 136-3
BE 236-3
BE 136-2
BE 236-2
BE 232-4-UN
21W
Eco
Eco
Americana
14W
1800
1200
36W
70W
1200
32w
1500
1200
32w
58W
1200
32w
BE-236-UN-277V
900
Europea
BE 149-T5-S
750
25w
30W
BE 149-T5-S
BE 149-T5-S
BE-236-UN-277V
600
700
BE 118-4-UN
BE 218-4-UN
BE 136-3
BE 236-3
BE 136-2
BE 236-2
25w
BE 118-4-UN
BE 218-4-UN
BE 136-3
BE 236-3
BE 136-2
BE 236-2
18W
BE 149-T5-S
SLIM
550
Eco
110-277V
110-240V
BE 118-4-UN
BE 218-4-UN
21X24X324
BE-T5-S
600
BE 136-3
BE 236-3
BE 136-2
BE 236-2
28x40x230
BE-277V
28x40x230
BE-4
BE-UN
16w
28x40x230
BE-3
28x40x230
BE-2
15w
450
Otros
Potencia Longitud
15W
Others
Length
Power
&RPELQDWLRQVEHWZHHQ(/7HOHFWURQLFEDOODVWVDQGÀXRUHVFHQWODPSV
&RPELQDFLRQHVGHEDODVWRVHOHFWUyQLFRV(/7FRQOiPSDUDVÀXRUHVFHQWHV
BE 226-TC-4-UN
BE 218-TC-4-UN
BE 213-TC-4-UN
BE 226-TC-4-UN
BE 226-TC-4-UN
BE 226-TC-4-UN
BE 226-TC-4-UN
110-240V
29,5x69x108
BE-TC-4-UN
BE 226-TC-4-UN-C2
BE 218-TC-4-UN-C2
BE 213-TC-4-UN-C2
BE 226-TC-4-UN-C2
BE 226-TC-4-UN-C2
BE 226-TC-4-UN-C2
BE 226-TC-4-UN-C2
110-240V & CII
32x70,2x170,5
BE-TC-4-UN-C2
www.elt.es
125
PL-R
TC
2G7
GR10q
TC-DD/DDE
GR10q
T9-C
G10q
T5C
2Gx13
TC-T/E
Gx24q
Lámpara
Lamp
1X
BE 213-TC-5-C2
CII
29,5x69x108
DBE 118/57-TC-DALI
DBE 118/57-TC-DALI
42W
57W
BE 155-T5C-2
55w
17w
BE-114-35-T5-S
BE 213-TC-5
11w
BE-114-35-T5-S
BE 213-TC-5
14w
BE 213-TC-5
9w
BE 213-TC-5-C2
BE 213-TC-5-C2
BE 213-TC-5-C2
BE 213-TC-5-C2
BE 226-TC-5-C2
BE 242-TC-5-C2
BE 226-TC-5
BE 242-TC-5
BE 213-TC-5
BE 226-TC-5-C2
BE 242-TC-5-C2
BE 242-TC-5-C2
BE 242-TC-5-C2
BE 226-TC-5
BE 242-TC-5
BE 242-TC-5
BE 242-TC-5
7w
28w
21w
BE-114-35-T5-S
40W
16w
BE 236-2
32W
BE-114-35-T5-S
BE 136-4-UN
BE 236-4-UN
BE 136-2
BE 236-2
22W
10w
BE 136-4-UN
BE 236-4-UN
BE 136-2
BE 236-2
60w
BE 236-2
40w
22W
70W
DBE 118/57-TC-DALI
DBE 118/57-TC-DALI
26W
32W
BE 226-TC-5-C2
BE 242-TC-5-C2
29,5x69x108
BE-TC-5-C2
BE 226-TC-5
BE 242-TC-5
DALI
33x79x123
BE-TC-5
BE 226-TC-5-C2
BE 242-TC-5-C2
1… 10V
26x30x360
DBE-DALI
BE 226-TC-5
BE 242-TC-5
IP67
32x49x340
DBE
BE 226-TC-5-C2
BE 242-TC-5-C2
SLIM
21X24X324
BE-EN
BE 226-TC-5
BE 242-TC-5
110-277V
110-240V
BE-T5-S
BE 218-TC-5-C2
28x40x230
28x40x230
BE-277
BE 218-TC-5
BE 170-3-A
28x40x230
BE-4
BE-UN
BE 213-TC-5
BE 136-2
BE 236-2
28x40x230
BE-3
18W
Otros
Potencia Longitud
BE-2
13W
Others
Length
Power
&RPELQDWLRQVEHWZHHQ(/7HOHFWURQLFEDOODVWVDQGÀXRUHVFHQWODPSV
&RPELQDFLRQHVGHEDODVWRVHOHFWUyQLFRV(/7FRQOiPSDUDVÀXRUHVFHQWHV
BE 213-TC-4-UN
BE 213-TC-4-UN
BE 213-TC-4-UN
BE 213-TC-4-UN
BE 226-TC-4-UN
BE 226-TC-4-UN
BE 226-TC-4-UN
BE 226-TC-4-UN
BE 226-TC-4-UN
BE 218-TC-4-UN
BE 213-TC-4-UN
110-240V
29,5x69x108
BE-TC-4-UN
BE 213-TC-4-UN-C2
BE 213-TC-4-UN-C2
BE 213-TC-4-UN-C2
BE 213-TC-4-UN-C2
BE 226-TC-4-UN-C2
BE 226-TC-4-UN-C2
BE 226-TC-4-UN-C2
BE 226-TC-4-UN-C2
BE 226-TC-4-UN-C2
BE 218-TC-4-UN-C2
BE 213-TC-4-UN-C2
110-240V & CII
29,5x69x108
BE-TC-4-UN-C2
126
www.elt.es
TC
2G7
GR10q
TC-DD /DDE
GR10q
T9-C
G10q
T5C
2Gx13
TC-T/E
Gx24q
TC-D/E
TC-L
TC-F
2G11
T5HO
G5
T5HE G5
T8
G13
Lámparas
Lamps
2X
BE 236-2
BE 249-T5
BE-214-35-T5-S
BE 213-TC-5
BE 213-TC-5
BE 213-TC-5
9w
11w
BE 242-TC-5
BE 226-TC-5
BE 242-TC-5
BE 242-TC-5
7w
28w
BE-214-35-T5-S
16w
BE 236-2
32W
10w
BE 236-2
22W
40w
BE 236-4-UN
DBE 218/42-TC-DALI
42W
22W
DBE 218/42-TC-DALI
32W
BE 213-TC-5-C2
BE 213-TC-5-C2
BE 213-TC-5-C2
BE 242-TC-5-C2
BE 226-TC-5-C2
BE 242-TC-5-C2
BE 242-TC-5-C2
BE 242-TC-5-C2
BE 226-TC-5-C2
BE 242-TC-5-C2
BE 226-TC-5
BE 242-TC-5
DBE 218/42-TC-DALI
26W
BE 242-TC-5
BE 218-TC-5-C2
BE 218-TC-5
DBE 218/42-TC-DALI
18 W
BE 213-TC-5-C2
BE 226-TC-5-C2
BE 213-TC-5
BE 226-TC-5
BE 218-TC-5-C2
BE 213-TC-5-C2
BE 242-TC-5-C2
13W
26W
BE 213-TC-5
BE 242-TC-5
BE 242-TC-5-C2
BE 226-TC-5-C2
BE 242-TC-5-C2
BE 226-TC-5
BE 242-TC-5
BE 242-TC-5
BE 226-TC-5-C2
BE 242-TC-5-C2
CII
29,5x69x108
BE-TC-5-C2
BE 226-TC-5
BE 242-TC-5
BE 218-TC-5
DBE 218/42-TC-DALI
DBE 218/42-TC-DALI
DBE 235/49/80-DALI
DBE 228/54-DALI
DBE 235/49-DALI
DBE 235/49/80-DALI
DBE 221/39-DALI
DBE 214/24-DALI
DBE 235/49-DALI
DBE 235/49/80-DALI
DBE 228/54-DALI
DBE 221/39-DALI
DBE 214/24-DALI
DBE 258-DALI
DBE 236-DALI
DBE 218-DALI
29,5x69x108
BE-TC-5
18W
BE 236-4-UN
BE 280-T5
DBE-DALI
21x30x423
21x30x425
33x79x123
DALI
13W
80w
DBE 254-58
BE 258-2
DBE 218-40
DBE 218-40
DBE 218-40
DBE 254-58
55W
BE 236-2
36W
BE 254-T5-EN
BE 249-T5-EN
DBE 218-40
DBE 218-40
DBE 218-40
BE 236-2
24W
BE-280-T5
BE 224-T5-EN
BE 239-T5-EN
DBE 214-35
DBE 214-35
DBE 214-35
DBE 214-35
DBE 254-58
DBE 254-58
DBE 218-40
DBE 218-40
DBE 218-40
DBE 218-40
DBE 218-40
DBE 218-40
DBE 218-40
DBE 218-40
DBE 218-40
1… 10V
26x30x360
DBE
40w
BE 236-2
18W
BE 280-T5
BE 254-T5
54W
80W
BE 249-T5
49W
BE 258-2
BE 224-T5-S
BE 236-2
BE 236-2
24W
39W
BE 239-T5-S
BE-214-35-T5-S
BE-214-35-T5-S
BE-214-35-T5-S
35W
BE 236-4-UN
BE-214-28-UN-277V
1150
BE-214-21-T5-S-UN BE-214-28-UN-277V
21W
BE 258-EN
BE 236-EN
BE 236-EN
BE 218-EN
BE 218-EN
BE 218-EN
IP67
32x49x340
BE-EN
BE 258-3
BE-214-35-T5-S
28x40x360
BE - LONG
BE 258-EN
BE 249-T5
21X24X324
BE-T5-S
BE 258-3
BE-236-UN-277V
28W
BE 258-2
BE 258-2
BE 236-4-UN
BE 236-4-UN
BE-214-21-T5-S-UN BE-214-28-UN-277V
1500
58W
Eco
BE 236-3
BE 236-3
14W
1500
51w
BE 236-2
BE 236-2
BE 232-4-UN
BE 218-4-UN
BE-236-UN-277V
Eco
1200
1200
1200
32w
32w
1200
32w
36W
Americana
900
Europea
BE 249-T5
750
25w
30W
BE 236-3
BE 249-T5
BE 249-T5
BE 236-2
BE-236-UN-277V
600
700
BE 249-T5
25w
BE 218-4-UN
18W
BE 236-3
720
BE 236-2
16w
Eco
21x31x360
600
110-277V
28x40x230
BE-T5
550
BE 218-4-UN
110-240V
28x40x230
BE-277
28x40x230
16w
BE 236-3
28x40x230
BE-4
BE-UN
15w
BE 236-2
28x40x230
BE-3
450
Otros
Potencia Longitud
BE-2
15W
Others
Length
Power
&RPELQDWLRQVEHWZHHQ(/7HOHFWURQLFEDOODVWVDQGÀXRUHVFHQWODPSV
&RPELQDFLRQHVGHEDODVWRVHOHFWUyQLFRV(/7FRQOiPSDUDVÀXRUHVFHQWHV
BE 213-TC-4-UN
BE 213-TC-4-UN
BE 213-TC-4-UN
BE 226-TC-4
BE 226-TC-4
BE 218-TC-4
BE 213-TC-4
BE 226-TC-4
BE 218-TC-4
BE 213-TC-4
BE 226-TC-4-UN
BE 226-TC-4-UN
29,5x69x108
BE-TC-4-UN
BE 213-TC-4-UN-C2
BE 213-TC-4-UN-C2
BE 213-TC-4-UN-C2
BE 226-TC-4-UN-C2
BE 226-TC-4-UN-C2
BE 218-TC-4-UN-C2
BE 213-TC-4-UN-C2
BE 226-TC-4-UN-C2
BE 218-TC-4-UN-C2
BE 213-TC-4-UN-C2
BE 226-TC-4-UN-C2
BE 226-TC-4-UN-C2
CII
29,5x69x108
BE-TC-4-UN-C2
www.elt.es
127
TC-L
TC-F
2G11
T5HO G5
T5HE
G5
T8
G13
Lámparas
Lamps
4X
TC-L
TC-F
2G11
T5HO G5
T5HE G5
T8 G13
Lámparas
Lamps
3X
600
900
1200
1200
18W
30W
32w
36W
BE 436-2-EN
BE 336-2
BE 436-2
1200
BE 436-2-EN
BE 436-2-EN
BE 436-2
36W
BE 436-2-EN
BE 436-2-EN
BE 436-2-EN
BE 436-2-EN
BE 436-2-EN
BE 436-2-EN
BE 424-T5-2
BE 436-2
BE 436-2
BE 436-2
BE 424-T5-2
BE 436-2
BE-414-T5-4-UN
BE-418-4-UN
BE 436-2-EN
BE 436-2-EN
24W
BE 418-2
BE 414-T5-2
BE 418-2
BE-EN
32x49x340
IP67
BE 424-T5-2
BE 436-2
18W
24W
14W
13w
8w
BE 436-2
1200
32w
36W
Eco
BE 436-2
600
900
BE 436-2
18W
BE-418-4-UN
30W
BE 418-2
450
BE 436-2
28x40x360
BE - LONG
BE 436-2-EN
BE 336-2
BE 436-2
600
BE-418-4-UN
28x40x230
110-240V
BE 436-2-EN
16w
BE 418-2
28x40x230
BE 436-2-EN
BE 436-2-EN
BE 424-T5-2
BE 436-2
BE 436-2
BE 436-2-EN
BE 424-T5-2
BE 436-2
15W
Eco
Potencia Longitud Otros
Power
BE-2
BE 324-T5-2
24W
BE 324-T5-2
BE-4
BE-UN
BE 436-2-EN
BE 336-2
BE 436-2
BE 424-T5-2
BE 436-2
BE 436-2-EN
BE 336-2
BE 436-2
BE 314-T5-2
BE 414-T5-2
BE 436-2-EN
BE-324-T5-2
BE 436-2
BE 318-2
BE 418-2
BE 436-2-EN
BE 336-2
BE 436-2
BE 436-2-EN
IP67
BE 318-2
BE 418-2
18W
36W
BE-EN
32x49x340
BE 336-2
BE 436-2
28x40x360
BE - LONG
BE 318-2
BE 418-2
BE-414-T5-4-UN
110-240V
BE-4
28x40x230
BE-2
28x40x230
BE 318-2
BE 418-2
39W
24W
Eco
Eco
Length Others
600
16w
14W
450
15W
Otros
Length Others
Potencia Longitud
Power
DBE 414/24-DALI
DBE 414/24-DALI
DBE 418-DALI
21x40x360
DALI
DBE-DALI
DBE 314/24-DALI
DBE 314/24-DALI
DBE 318-DALI
DALI
21x40x360
DBE-DALI
&RPELQDWLRQVEHWZHHQ(/7HOHFWURQLFEDOODVWVDQGÀXRUHVFHQWODPSV
&RPELQDFLRQHVGHEDODVWRVHOHFWUyQLFRV(/7FRQOiPSDUDVÀXRUHVFHQWHV
&RPELQDWLRQVHOHFWURQLFEDOODVWVÀXRUHVFHQWODPSV
&RPELQDFLRQHVEDODVWRVHOHFWUyQLFRVOiPSDUDVÀXRUHVFHQWHV
Type
5QEMGV
TC-S/E
T8
T5HE
T5HO
TC-L/F
TC-D/E
TC-T/E
T5C
T9C TC-DD TC-R
2G7
G13
G5
G5
2G11/2G10
G24q
Gx24q
2G13
2Gx13
G10q
GR10q GR14q
Format
Power (W)
BE 213-TC-5
BE 218-TC-5
BE 226-TC-5
BE 242-TC-5
BE 213-TC-4-UN
BE 218-TC-4-UN
BE 226-TC-4-UN
BE 242-TC-4-UN
BE 136-2
BE 158-2
BE 236-2
BE 258-2
BE 418-2
BE 436-2
BE 136-3
BE 158-3
BE 236-3
BE 258-3
BE 155-T5C-2
BE 170-3-A
BE 118-4-UN
BE 136-4-UN
BE 158-4-UN
BE 218-4-UN
BE 236-4-UN
BE 418-4-UN
BE 114-35-T5-S
BE 214-35-T5-S
BE 124-T5-S
BE 139-T5-S
BE 149-T5-S
BE 154-T5-S
BE 180-T5-S
BE 224-T5-S
BE 239-T5-S
BE 114-21-T5-S-UN
BE 214-21-T5-S-UN
BE-158-UN-277V
BE 236-UN-277V
BE 214-28-UN-277V
BE 249-T5
BE 254-T5
BE 280-T5
BE 324-T5-2
BE 414-T5-2
BE 414-T5-4-UN
BE 424-T5-2
DBE 114-35
DBE 118-40
DBE 154-58
DBE 214-35
DBE 218-40
DBE 254-58
DBE 118-DALI
DBE 136-DALI
DBE 158-DALI
DBE 114/24-DALI
DBE 121/39-DALI
DBE 128/54-DALI
DBE 135/49/80-DALI
DBE 118/57-TC-DALI
DBE 218-DALI
DBE 236-DALI
DBE 258-DALI
DBE 214/24-DALI
DBE 221/39-DALI
DBE 228/54-DALI
DBE 235/49-DALI
DBE 235/49/80-DALI
DBE 218/42-TC-DALI
GR10q
5 7 9 11 14 15 18 30 36 58 70 14 21 28 35 24 39 49 54 80 18 24 36 40 55 80 10 13 18 26 13 18 26 32 42 57 70 22 40 55 60 22 32 40 16 28 38 14 17
Ŗ Ŗ Ŗ
Ŗ
Ŗ Ŗ Ŗ Ŗ
Ŗ Ŗ Ŗ Ŗ
Ŗ Ŗ Ŗ
Ŗ Ŗ Ŗ Ŗ
Ŗ Ŗ Ŗ Ŗ
Ŗ Ŗ
Ŗ Ŗ Ŗ Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ Ŗ
Ŗ
Ŗ
Ŗ Ŗ
Ŗ
Ŗ Ŗ Ŗ
Ŗ Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ Ŗ Ŗ
Ŗ Ŗ
Ŗ Ŗ Ŗ Ŗ Ŗ Ŗ Ŗ
Ŗ Ŗ Ŗ
Ŗ Ŗ
Ŗ Ŗ Ŗ Ŗ Ŗ Ŗ Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ Ŗ
Ŗ Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ Ŗ Ŗ Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ Ŗ
Ŗ
Ŗ Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ Ŗ Ŗ Ŗ
Ŗ
Ŗ
Ŗ Ŗ
Ŗ
Ŗ
Ŗ
Ŗ Ŗ
Ŗ
Ŗ
Ŗ
Ŗ Ŗ Ŗ Ŗ
Ŗ
Ŗ Ŗ Ŗ
Ŗ
Ŗ Ŗ Ŗ Ŗ
Ŗ Ŗ Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ Ŗ
Ŗ Ŗ
Ŗ
Ŗ
Ŗ Ŗ Ŗ Ŗ
Ŗ Ŗ Ŗ Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ Ŗ
Ŗ
Ŗ Ŗ Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ Ŗ Ŗ
Ŗ
Ŗ
Ŗ Ŗ
Ŗ
Ŗ Ŗ Ŗ Ŗ
Ŗ Ŗ Ŗ Ŗ
Ŗ Ŗ Ŗ
Ŗ
Ŗ
Ŗ Ŗ Ŗ Ŗ
Ŗ
Ŗ Ŗ
Ŗ Ŗ Ŗ Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ Ŗ
Ŗ Ŗ
Ŗ Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ Ŗ
Ŗ Ŗ Ŗ Ŗ Ŗ
Ŗ Ŗ
Ŗ Ŗ Ŗ Ŗ
Ŗ
Ŗ
%QODKPCVKQPU'.6GNGEVTQPKEDCNNCUVUCPFƀWQTGUEGPVNCORU
JVVRYYYGNVGURTQFWEVQUEQODKPCEKQPGUEQOAƀWQRFH
%QODKPCEKQPGUFGDCNCUVQUGNGEVTÎPKEQU'.6EQPN¶ORCTCUƀWQTGUEGPVGU
JVVRYYYGNVGURTQFWEVQUEQODKPCEKQPGUEQOAƀWQRFH
128
www.elt.es
AC1
220V
50Hz
Ballasts for compact lamps
Reactancias para lámparas compactas
41
Serie
28,5
0,5-1
0,5-1
L2
8
8
L1
Lámpara
Model
Modelo
Screw
connect.
Conex.
Tornillo
AC1 04/22-SP-2
AC1 09/22-SP-2
1111360
Power
factor
ţVţVan
2WUJYKTG Power
connect. Potencia
Cap
Conex.
Casquillo
W
Rápida
Current
Intensidad
&KOGPUKQPU
Dimensiones
Factor de
potencia
9KTKPI
FKCITCO
Index
Approvals
Lamp
Ref. No.
Esquema Índice
conexión
A
K
NJ
L1
mm
L2
mm
nº
EEI
Homologaciones
4,5
1111310
4
6
8
2x4
G5
0,170
0,160
0,153
0,170
50/80
0,29
0,32
0,39
0,34
74
85
1-2
1-2
1-2
3
B2
01
1111010
5
7
9
11
2x5
G23
0,180
0,175
0,170
0,155
0,170
50/95
0,27
0,30
0,35
0,45
0,40
74
85
6
6
6
6
4
B2
01
G24d-1
G24d-1
G5
G5
G23
G23
G23
0,185
0,165
0,165
0,160
0,180
0,175
0,170
50/95
0,38
0,47
0,47
0,45
0,38
0,49
0,58
74
85
6
6
1-2
3
4
4
4
B2
01
AC1 13/22-SP-2
1111370
1111140
10
13
13
2x6
2x5
2x7
2x9
AC1 16/22-SP-2
1111760
1111160
16
2x8
16
G5
G5
GR8
0,200
0,175
0,200
50/95
0,50
0,55
0,50
74
85
1-2
3
6
B2
-
18
G24d-2
0,220
50/100
0,50
98
110
6
B1
-
G24d-3
2G11
2G11
GR8
0,310
0,370
0,340
0,325
60/100
0,48
0,33
0,44
0,50
129
150
6
7
7
6
B2
D
C
B2
01
AC1 18/22-D-SC-1
AC1 2/22-SC-2
1112750
1112680
26
18 (1)
24 (1)
28
AC1 26/22-SC
1113107
1113106
24
26
2G11
G24d-3
0,345
0,325
55/110
0,50
98
110
6-7
B2
01
1112720
36
38 (1)
2x18
1G11
GR10q
2G11
0,430
0,430
0,370
65/150
0,48
0,50
0,48
129
150
7
7
5
D
01
(1)
AC1 4/22-SC-2
1112790
(1) Not available for European Union Market.
For EU Market request EEI=B2 ballasts
~ Ballasts for built-in use. Indoor use.
~ Vacuum impregnated in polyester resin.
~ Thermal class tw=130°C.
~ Available with push wire (0,5-1 mm2) or screw connection
(2,5 mm2).
~ Further types on request.
(1) No instalar dentro de la Unión Europea.
Para Unión Europea solicitar reactancias con EEI=B2
~ Reactancias para incorporar. Uso interior.
~ Impregnadas al vacío en resina de poliéster.
~ Clase térmica tw=130°C.
~ Disponibles con clema de conexión rápida.
(0,5-1 mm2) o por tornillo (2,5 mm2).
~ Otros tipos bajo demanda.
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
2TQFWEVUGNGEVKQPRCICPFYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
Selección de producto pág. 142 y www.elt.es/productos/buscador_producto.html
R
R
C
N
N
L
DUO EN SERIE
DUO IN SERIES
COMPENSADO
COMPENSATED
INDUCTIVO
INDUCTIVE
N
7
6
5
R
L
L
C
R
R
L
L
L
L
EN-61347-2-8
EN-60921
www.elt.es
C
C
C
L
N
L
L
C
C
N
R
R
L
L
L
4
3
2
1
C
N
129
N
C
AC1
220V
60Hz
Ballasts for compact lamps
Reactancias para lámparas compactas
Serie
41
28,5
0,5-1
0,5-1
L2
8
8
L1
4,5
Lamp
Ref. No.
Lámpara
Model
Power
Potencia
Screw
connect.
Conex.
Tornillo
Push-wire
connect.
Conex.
Rápida
#%52
1116250
1116252
4
6
8
2x4
#%52
1116140
1116900
Modelo
Cap
Casquillo
ţVţVan
Current
Intensidad
Power
factor
Factor de
potencia
Wiring
diagram
Dimensions
Dimensiones
Esquema
conexión
L2
mm
nº
Approvals
Homologaciones
A
K
NJ
L1
mm
G5
0,170
0,160
0,153
0,170
45/70
0,23
0,28
0,33
0,33
74
85
1-2
1-2
1-2
3
-
5
7
9
11
2x5
G23
0,180
0,175
0,170
0,155
0,160
45/80
0,29
0,35
0,38
0,50
0,45
74
85
6
6
6
6
4
-
G24d-1
G24d-1
G5
G5
G23
G23
G23
0,185
0,165
0,165
0,160
0,180
0,175
0,170
50/95
0,40
0,49
0,49
0,48
0,40
0,51
0,51
74
85
6
6
1-2
3
4
4
4
-
1-2
3
6
-
W
#%52
1116780
1116990
10
13
13
2x6
2x5
2x7
2x9
#%52
1116090
-
16
2x8
16
G5
G5
GR8
0,200
0,175
0,200
55/100
0,50
0,55
0,50
74
85
#%&5%
1116158
1116155
18
G24d-2
0,220
55/110
0,50
98
110
6
-
#%5%
-
1116201
24
26
2G11
G24d-3
0,345
0,325
55/110
0,42
0,45
98
110
6-7
-
#%5%
1116400
1116350
18
24
26
28
2G11
2G11
G24d-3
GR8
0,370
0,340
0,310
0,325
65/100
0,36
0,44
0,51
0,52
129
150
7
7
6
6
01
#%5%
1116460
1116390
36
38
2x18
2G11
GR10q
2G11
0,430
0,430
0,370
60/140
0,47
0,49
0,49
129
150
7
7
5
01
~ Ballasts for built-in use. Indoor use.
~ Vacuum impregnated in polyester resin.
~ Thermal class tw=130°C.
~ Available with push wire (0,5-1 mm2) or screw connection
(2,5 mm2).
~ Further types on request.
~ Reactancias para incorporar. Uso interior.
~ Impregnadas al vacío en resina de poliéster.
~ Clase térmica tw=130°C.
~ Disponibles con clema de conexión rápida. (0,5-1 mm2) o por
tornillo (2,5 mm2).
~ Otros tipos bajo demanda.
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
2TQFWEVUGNGEVKQPRCICPFYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
Selección de producto pág. 142 y www.elt.es/productos/buscador_producto.html
1
R
3
R
INDUCTIVO
INDUCTIVE
L
L
C
N
N
L
DUO EN SERIE
DUO IN SERIES
COMPENSADO
COMPENSATED
5
N
6
R
L
R
C
C
N
4
R
L
L
L
7
R
L
R
L
C
L
L
C
EN-61347-2-8
EN-60921
L
N
L
C
C
C
C
N
130
N
www.elt.es
AC 1
230V
50Hz
Ballasts for compact lamps
Reactancias para lámparas compactas
41
Serie
28,5
0,5-1
0,5-1
L2
8
8
L1
Lámpara
Model
Power
Potencia
Screw
connect.
Conex.
Tornillo
2WUJYKTG
connect.
Conex.
Rápida
AC1 04/23-SP
1111471
1111470
4
6
8
2x4
AC1 09/23-SP
1111652
1111650
Modelo
ţVţVan
Cap
Casquillo
Current
Intensidad
Power
factor
Factor de
potencia
9KTKPI
FKCITCO
&KOGPUKQPU
Dimensiones
Index
Esquema
conexión
Índice
Homologaciones
Lamp
Ref. No.
Approvals
4,5
A
K
NJ
L1
mm
L2
mm
nº
EEI
G5
0,170
0,160
0,153
0,170
55/80
0,26
0,29
0,32
0,32
74
85
1-2
1-2
1-2
3
B2
B1
B1
B1
01
5
7
9
11
2x5
G23
0,180
0,175
0,170
0,155
0,170
60/80
0,30
0,33
0,38
0,47
0,43
74
85
6
6
6
6
4
B2
B2
B2
B1
B1
01
G24d-1
G24d-1
G5
G5
G23
G23
G23
0,185
0,165
0,165
0,160
0,180
0,175
0,170
55/100
0,38
0,47
0,47
0,49
0,38
0,49
0,57
74
85
6
6
1-2
3
4
4
4
B2
B1
B1
B1
B1
B1
B1
01
W
AC1 13/23-SP
1111671
1111670
10
13
13
2x6
2x5
2x7
2x9
AC1 16/23-SP
1111731
1111730
16
2x8
16
G5
G5
GR8
0,200
0,175
0,200
55/120
0,46
0,50
0,46
74
85
1-2
3
6
B1
01
AC1 18/23-D-SC-1
1111633
1111632
18
G24d-2
0,220
55/120
0,50
98
110
6
B1
01
2G11
2G11
G24d-3
GR8
0,370
0,340
0,310
0,325
50/100
0,30
0,40
0,46
0,47
129
150
7
7
6
6
B2
B1
B1
B2
01
AC1 2/23-B2-SC
1113055
1113050
18
24
26
28
AC1 26/23-SC
1113102
1113103
24
26
2G11
G24d-3
0,345
0,325
60/120
0,42
0,45
98
110
6-7
B2
01
AC1 4/23-B2-SC
1113065
1113060
36
38
2x18
2G11
GR10q
2G11
0,430
0,430
0,370
50/160
0,45
0,47
0,48
129
150
7
7
5
B2
01
AC1 2/23-BP-SC
-
1112860
18
24
26
28
2G11
2G11
G24d-3
GR8
0,370
0,340
0,310
0,325
35/50
0,29
0,39
0,46
0,47
140
150
7
7
6
6
B1
01
AC1 4/23-BP-SC
-
1112870
36
38
2x18
2G11
GR10q
2G11
0,430
0,430
0,370
35/80
0,44
0,46
0,47
140
150
7
7
5
B1
01
~ Ballasts for built-in use. Indoor use.
~ Vacuum impregnated in polyester resin.
~ Thermal class tw=130°C.
~ Available with push wire (0,5-1 mm2) or screw connection
(2,5 mm2).
~ Further types on request.
~ Reactancias para incorporar. Uso interior.
~ Impregnadas al vacío en resina de poliéster.
~ Clase térmica tw=130°C.
~ Disponibles con clema de conexión rápida. (0,5-1 mm2) o por
tornillo (2,5 mm2).
~ Otros tipos bajo demanda.
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
2TQFWEVUGNGEVKQPRCICPFYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
Selección de producto pág. 142 y www.elt.es/productos/buscador_producto.html
1
2
R
3
R
L
L
L
C
L
DUO EN SERIE
DUO IN SERIES
COMPENSADO
COMPENSATED
5
N
6
R
L
L
L
N
N
INDUCTIVO
INDUCTIVE
R
C
C
N
4
R
7
R
L
R
L
C
L
L
C
EN-61347-2-8
EN-60921
www.elt.es
L
N
L
C
C
C
N
131
N
C
Ballasts for compact lamps
Reactancias para lámparas compactas
41
Serie
28,5
0,5-1
0,5-1
L2
8
8
L1
Lamp
Ref. No.
Lámpara
Model
Power
Potencia
Screw
connect.
Conex.
Tornillo
2WUJYKTG
connect.
Conex.
Rápida
AC1 04/24-SP
1111340
1111780
4
6
8
2x4
AC1 09/24-SP
-
1111790
Modelo
ţVţVan
Cap
Casquillo
Current
Intensidad
Power
factor
Factor de
potencia
9KTKPI
KK
FKCITCO
&KOGPUKQPU
Dimensiones
Index
Esquema
conexión
Índice
Homologaciones
4,5
Approvals
AC1
240V
50Hz
A
K
NJ
L1
mm
L2
mm
nº
EEI
G5
0,170
0,160
0,153
0,170
55/75
0,26
0,28
0,34
0,33
74
85
1-2
1-2
1-2
3
B2
B2
B1
B1
01
5
7
9
11
2x5
G23
0,180
0,175
0,170
0,155
0,170
60/90
0,27
0,33
0,35
0,45
0,42
74
85
6
6
6
6
4
B2
B2
B1
B1
B1
01
G24d-1
G24d-1
G5
G5
G23
G23
G23
0,185
0,165
0,165
0,160
0,180
0,175
0,170
60/110
0,34
0,42
0,42
0,43
0,34
0,46
0,56
74
85
6
6
1-2
3
4
4
4
B2
01
W
AC1 13/24-SP
1111801
1111800
10
13
13
2x6
2x5
2x7
2x9
AC1 16/24-SP
-
1111890
16
2x8
16
G5
G5
GR8
0,200
0,175
0,200
55/110
0,46
0,50
0,46
74
85
1-2
3
6
B1
01
AC1 18/24-D-SC-1
-
1111623
18
G24d-2
0,220
55/120
0,46
98
110
6
B2
01
2G11
2G11
G24d-3
GR8
0,370
0,340
0,310
0,325
55/100
0,29
0,39
0,45
0,46
129
150
7
7
6
6
B2
B1
B1
B2
01
AC1 2/24-B2-SC
1113046
1113057
18
24
26
28
AC1 26/24-SC
1113104
1113101
24
26
2G11
G24d-3
0,345
0,325
60/120
0,41
0,44
98
110
6-7
B2
B1
01
AC1 4/24-B2-SC
1112493
1113069
36
38
2x18
2G11
GR10q
2G11
0,430
0,430
0,370
55/160
0,44
0,46
0,47
129
150
7
7
5
B2
01
~ Ballasts for built-in use. Indoor use.
~ Vacuum impregnated in polyester resin.
~ Thermal class tw=130°C.
~ Available with push wire (0,5-1 mm2) or screw connection
(2,5 mm2).
~ Further types on request.
~ Reactancias para incorporar. Uso interior.
~ Impregnadas al vacío en resina de poliéster.
~ Clase térmica tw=130°C.
~ Disponibles con clema de conexión rápida. (0,5-1 mm2) o por
tornillo (2,5 mm2).
~ Otros tipos bajo demanda.
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
2TQFWEVUGNGEVKQPRCICPFYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
Selección de producto pág. 142 y www.elt.es/productos/buscador_producto.html
1
2
R
C
N
N
INDUCTIVO
INDUCTIVE
L
DUO EN SERIE
DUO IN SERIES
COMPENSADO
COMPENSATED
5
L
N
6
R
L
L
C
C
N
R
R
L
L
L
4
3
R
7
R
L
R
L
C
L
L
C
EN-61347-2-8
EN-60921
L
N
L
C
C
C
C
N
132
N
www.elt.es
%DOODVWVIRUWXEXODUÀXRUHVFHQWODPSV
5HDFWDQFLDVSDUDOiPSDUDVÀXRUHVFHQWHVWXEXODUHV
AC1
220V
50Hz
SC
Serie
28,5
41
4,5
L1
Lámpara
Model
Screw
connect.
Conex.
Tornillo
Modelo
AC1 15/22-SC-2
2WUJYKTG
connect.
Conex.
Rápida
Power
Potencia
W
Cap
Casquillo
Power
factor
ţVţVan
Factor de
potencia
Current
Intensidad
&KOGPUKQPU
Dimensiones
A
K
NJ
L1
mm
L2
mm
9KTKPI
FKCITCO
Index
Esquema
conexión
Índice
nº
EEI
Approvals
Lamp
Ref. No.
Homologaciones
L2
1112740
1112670
15
G13
0,330
60/100
0,32
129
150
1-2
C
01
AC1 2/22-SC-2(*)
1112750
1112680
18
20
G13
G13
0,370
0,370
60/100
0,35
129
150
1-2-4
D
01
AC1 25/22-SC-2(*)
1112760
1112690
25
G13
0,290
55/100
0,51
129
150
1-2
C
01
G13
G13
0,365
0,330
60/135
0,50
129
150
1-2
3
C
01
70/140
0,43
129
150
1-2
D
01
D
01
C
01
(*)
(*)
1112770
1112700
30
2x15
AC1 32/22-SC-2
1112780
1112710
32
G10q
0,450
36
40
2x18
2x20
G13
G13
G13
G13
0,430
0,430
0,370
0,370
65/150
58
65
G13
G13
0,670
0,670
60/160
AC1 3/22-SC-2
(*)
AC1 4/22-SC-2(*)
AC1 6/22-SC(*)
1112790
1112952
1112720
1112950
0,52
1-2-4
129
150
0,55
0,52
3
175
190
1-2
0QVCXCKNCDNGHQT'WTQRGCP7PKQP/CTMGV
(QT'7/CTMGVTGSWGUV''+$DCNNCUVU
~ Ballasts for built-in use. Indoor use.
~ Vacuum impregnated in polyester resin.
~ Thermal class tw=130°C.
~ Available with push wire (0,5-1 mm2) or screw connection
(2,5 mm2).
~ Further types on request.
~ Earth connection upon request.
~ Available with push wire connection for automatic wiring by robot
type ALF.
(*) No instalar dentro de la Unión Europea.
Para Unión Europea solicitar reactancias con EEI=B2
~ Reactancias para incorporar. Uso interior.
~ Impregnadas al vacío en resina de poliéster.
~ Clase térmica tw=130°C.
~ Disponibles con clema de conexión rápida. (0,5-1 mm2) o por
tornillo (2,5 mm2).
~ Otros tipos bajo demanda.
~ Bajo pedido se suministrarán con toma tierra.
~ Disponible bajo demanda con clema de inserción para el cableado
automático.
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
1
2
R
R
L
L
N
N
C
COMPENSADO
COMPENSATED
INDUCTIVO
INDUCTIVE
3
4
R
L
C
L
N
www.elt.es
N
DUO EN SERIE
DUO IN SERIES
EN-61347-2-8
EN-60921
133
COMPENSACION DUO
( Efecto estroboscópico corregido)
DUO COMPENSATION
( Stroboscopic effect corrected )
AC1
220V
60Hz
%DOODVWVIRUWXEXODUÀXRUHVFHQWODPSV
5HDFWDQFLDVSDUDOiPSDUDVÀXRUHVFHQWHVWXEXODUHV
28,5
41
4,5
L1
L2
Lamp
Ref. No.
Lámpara
Model
Screw
connect.
Conex.
Tornillo
2WUJYKTG
connect.
Conex.
Rápida
Power
Potencia
AC1 15/22-SC-26
1116410
1116340
15
G13
AC1 2/22-SC-26
1116400
1116350
18
20
G13
G13
Modelo
W
Cap
Casquillo
Power
factor
ţVţVan
Factor de
potencia
Current
Intensidad
&KOGPUKQPU
Dimensiones
L2
mm
9KTKPI
FKCITCO
Esquema
conexión
K
NJ
L1
mm
0,330
60/90
0,32
129
150
1-2
0,370
0,370
65/100
0,35
129
150
1-2-4
A
Approvals
Homologaciones
nº
01
AC1 25/22-SC-26
-
1116360
25
G13
0,290
55/100
0,51
129
150
1-2
-
AC1 3/22-SC-26
1116420
1116370
30
2x15
G13
G13
0,365
0,330
60/125
0,50
129
150
1-2
3
-
AC1 32/22-SC-26
1116381
1116380
32
G10q
0,430
65/140
0,43
129
150
1-2
01
129
150
AC1 4/22-SC-26
1116460
1116390
36
40
2x18
2x20
0,430
0,52
G13
60/150
0,370
1-2-4
0,55
01
3
~ Ballasts for built-in use. Indoor use.
~ Vacuum impregnated in polyester resin.
~ Thermal class tw=130°C.
~ Available with push wire (0,5-1 mm2) or screw connection
(2,5 mm2).
~ Further types on request.
~ Earth connection upon request.
~ Reactancias para incorporar. Uso interior.
~ Impregnadas al vacío en resina de poliéster.
~ Clase térmica tw=130°C.
~ Disponibles con clema de conexión rápida. (0,5-1 mm2) o por
tornillo (2,5 mm2).
~ Otros tipos bajo demanda.
~ Bajo pedido se suministrarán con toma tierra.
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
1
2
R
R
L
L
N
N
C
COMPENSADO
COMPENSATED
INDUCTIVO
INDUCTIVE
3
4
R
L
C
L
N
N
DUO EN SERIE
DUO IN SERIES
EN-61347-2-8
EN-60921
134
COMPENSACION DUO
( Efecto estroboscópico corregido)
DUO COMPENSATION
( Stroboscopic effect corrected )
www.elt.es
%DOODVWVIRUWXEXODUÀXRUHVFHQWODPSV
5HDFWDQFLDVSDUDOiPSDUDVÀXRUHVFHQWHVWXEXODUHV
AC1
230V
50Hz
28,5
41
4,5
L1
Lámpara
Model
Modelo
AC1 15/23-SC
AC2 2/23-B1-SC-3
AC1 2/23-B2-SC
AC1 2/23-BP-SC
AC1 25/23-SC
Power
Potencia
Screw
connect.
Conex.
Tornillo
2WUJYKTG
connect.
Conex.
Rápida
1112600
1112530
15
G13
1120010
2x18
2x20
1113050
18
20
1112620
1120011
1113055
Cap
Casquillo
ţVţVan
&KOGPUKQPU
Dimensiones
9KTKPI
FKCITCO
Index
Esquema
conexión
Índice
A
K
NJ
L1
mm
L2
mm
nº
EEI
0,330
55/85
0,29
129
150
1-2
B2
01
G13
0,37
55/140
0,52
129
150
3
B1
01
G13
G13
0,370
0,370
50/100
0,32
129
150
1-2-4
B2
01
1112860
18
20
G13
G13
0,370
0,370
35/50
0,31
140
150
1-2-4
B1
01
1112550
25
G13
0,290
45/95
0,46
129
150
1-2
B2
01
G13
G13
0,365
0,330
55/115
0,46
129
150
1-2
3
B2
01
55/140
0,40
129
150
1-2
B2
01
129
150
1-2-4
1-2-4
3
3
B2
01
140
150
B1
01
B2
01
W
AC1 3/23-SC
1112630
1112560
AC1 32/23-B2-SC
1112573
1112572
32
G10q
0,450
36
40
2x18
2x20
G13
G13
G13
G13
0,430
0,430
0,370
0,370
50/160
36
40
2x18
2x20
G13
G13
G13
G13
0,430
0,430
0,370
0,370
35/80
58
65
G13
G13
0,670
0,670
50/140
AC1 4/23-B2-SC
1113065
1113060
AC1 4/23-BP-SC
-
1112870
1113073
Factor de
potencia
Current
Intensidad
30
2x15
AC1 6/23-B2-SC
Power
factor
Approvals
Lamp
Ref. No.
Homologaciones
L2
1113072
0,46
0,48
0,46
1-2-4
0,47
0,47
3
175
190
1-2
~ Ballasts for built-in use. Indoor use.
~ Vacuum impregnated in polyester resin.
~ Thermal class tw=130°C.
~ Available with push wire (0,5-1 mm2) or screw connection
(2,5 mm2).
~ Further types on request.
~ Earth connection upon request.
~ Available with push wire connection for automatic wiring by robot
type ALF.
~ Reactancias para incorporar. Uso interior.
~ Impregnadas al vacío en resina de poliéster.
~ Clase térmica tw=130°C.
~ Disponibles con clema de conexión rápida. (0,5-1 mm2) o por
tornillo (2,5 mm2).
~ Otros tipos bajo demanda.
~ Bajo pedido se suministrarán con toma tierra.
~ Disponible bajo demanda con clema de inserción para el cableado
automático.
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
1
2
R
R
L
L
C
N
N
COMPENSADO
COMPENSATED
INDUCTIVO
INDUCTIVE
3
4
R
L
C
L
N
EN-61347-2-8
EN-60921
www.elt.es
N
DUO EN SERIE
DUO IN SERIES
135
COMPENSACION DUO
( Efecto estroboscópico corregido)
DUO COMPENSATION
( Stroboscopic effect corrected )
%DOODVWVIRUWXEXODUÀXRUHVFHQWODPSV
5HDFWDQFLDVSDUDOiPSDUDVÀXRUHVFHQWHVWXEXODUHV
28,5
41
4,5
L1
Lamp
Ref. No.
Lámpara
Model
Modelo
AC1 15/24-SC
AC1 2/24-B2-SC
AC1 25/24-SC
Screw
connect.
Conex.
Tornillo
2WUJYKTG
connect.
Conex.
Rápida
Power
Potencia
1112891
1112890
15
1113046
1113057
18
20
-
1112910
ţVţVan
Current
Intensidad
Cap
Casquillo
Power
factor
Factor de
potencia
&KOGPUKQPU
Dimensiones
9KTKPI
FKCITCO
Esquema
conexión
Índice
A
K
NJ
L1
mm
L2
mm
nº
EEI
G13
0,330
50/95
0,29
129
150
1-2
B2
01
G13
G13
0,370
0,370
55/100
0,30
129
150
1-2
B2
01
25
G13
0,290
50/100
0,44
129
150
1-2
B2
01
G13
G13
0,365
0,330
B2
01
B2
01
B2
01
B2
01
W
AC1 3/24-SC
1112923
1112920
30
2x15
60/130
0,47
129
150
1-2
3
AC1 32/24-B2-SC
1112931
1112574
32
G10q
0,450
55/160
0,40
175
190
1-2
36
40
2x18
2x20
G13
G13
G13
G13
0,430
0,430
0,370
0,370
55/160
129
150
58
65
G13
G13
0,670
0,670
55/140
AC1 4/24-B2-SC
AC1 6/24-B2-SC
1112493
1113079
1113069
1113078
Index
Homologaciones
L2
Approvals
AC1
240V
50Hz
1-2
0,44
0,51
3
0,44
175
190
1-2
~ Ballasts for built-in use. Indoor use.
~ Vacuum impregnated in polyester resin.
~ Thermal class tw=130°C.
~ Available with push wire (0,5-1 mm2) or screw connection
(2,5 mm2).
~ Further types on request.
~ Earth connection upon request.
~ Available with push wire connection for automatic wiring by robot
type ALF.
~ Reactancias para incorporar. Uso interior.
~ Impregnadas al vacío en resina de poliéster.
~ Clase térmica tw=130°C.
~ Disponibles con clema de conexión rápida. (0,5-1 mm2) o por
tornillo (2,5 mm2).
~ Otros tipos bajo demanda.
~ Bajo pedido se suministrarán con toma tierra.
~ Disponible bajo demanda con clema de inserción para el cableado
automático.
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
1
2
R
3
R
L
L
N
N
C
C
EN-61347-2-8
EN-60921
N
COMPENSADO
COMPENSATED
INDUCTIVO
INDUCTIVE
136
R
L
DUO EN SERIE
DUO IN SERIES
www.elt.es
(OHFWURQLFVWDUWHUVIRUÀXRUHVFHQWODPSV
&HEDGRUHVHOHFWUyQLFRVSDUDOiPSDUDVÀXRUHVFHQWHV
Ø21
AF1
200-240V
110-130V
50-60Hz
STANDARD TYPE / FORMATO ESTANDAR
Lamp
Model
Modelo
39
Voltage AC
Lámpara
Ref. No.
Tensión AC
Power
Potencia
W
35
AF1-005
3110060
14-15-20-25-40-65
15-18-30-36-58
18-36
22-32
AF1-006
3110070
14-15-20
15-18
18
22
Type
Tipo
Cap
Casquillo
T12
T8
TC
TR
G13
G13
2G11
G10q
200 a 240
T12
T8
TC
TR
G13
G13
2G11
G10q
200 a 240
(serie)
110-130
(simple)
8v
12,5
PROTECTED TYPE / FORMATO PROTEGIDO
Lamp
Model
Modelo
75
Ref. No.
55
Power
Potencia
W
10
14-15-20-25-40-65
15-18-30-36-58
18-36
22-32
Tensión AC
Type
Tipo
Cap
Casquillo
T12
T8
TC
TR
G13
G13
2G11
G10q
200 a 240
8v
AF1-001
3110010
AF1-004
3110040
13
T5
G5
200 a 240
AF1-003
3110050
14-15-20
15-18
18
22
T12
T8
TC
TR
G13
G13
2G11
G10q
200 a 240
(serie)
110-130
(simple)
AF1-0032 (*)
3110030
14-15-20
15-18
18
22
T12
T8
TC
TR
G13
G13
2G11
G10q
200 a 240
(serie)
110-130
(simple)
M8
Ø30
Voltage AC
Lámpara
+VCFOKVUUJQTVXQNVCIGFKR
8OUGI
(*) Preparado para soportar breves caídas de tensión (180V, 175 mseg.)
`'NGEVTQPKEUVCTVGTUVQDGKPEQTRQTCVGFKPUKFGƀWQTGUEGPVſVVKPIU
`6JGRTQVGEVGFV[RGKUſNNGFYKVJRQN[WTGVJCPGTGUKP5ETGY
connection.
~ Starting time aprox. 1-2 sec., with preheating of cathodes.
~ Pulse peak voltage 1,3 and 1,5 kV.
~ If the lamp does not start, the starter stops its operation within
5 seconds. Re-starts, after replacement of the lamp.
~ Working temperature -10 and +60°C.
~ Storage temperature -10 and +50°C.
~ Expected lifetime with more of 300.000 switches-on per lamp.
~ Cebadores electrónicos para incorporar en luminarias
~ El cebador protegido está encapsulado con resina de poliuretano, y
conexiones por tornillo sin necesidad de
portacebador.
~ Tiempo de encendido aproximadamente entre 1 y 2 seg. Con
precalentamiento de cátodos.
~ Impulso de encendido entre 1,3 y 1,5 kV.
`5KNCN¶ORCTCPQGPEKGPFGGPWPQUUGIWPFQU
ŭFGLCFG
dar impulsos, hasta su rearme cuando se repone o asegura la
conexión de la lámpara.
~ Margen de temperatura de funcionamiento correcto: -10 y +60 °C.
~ Temperatura de almacenamiento: -10 y +50°C.
~ Expectativa de vida media con más de 300.000 encendidos por
lámpara.
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
EN-60155
www.elt.es
137
Emergency lighting modules with self-diagnosis function
IRUWR:ÀXRUHVFHQWODPSV
Módulos para alumbrado de emergencia,
FRQDXWRGLDJQyVWLFRSDUDOiPSDUDVÀXRUHVFHQWHVGHD:
21.5
210
31.4
4.5
205,5
210
300
150
22
33
FES
220-230V
50-60Hz
250
240
175
1 h - 4SC NiCd 4.8V 1.8Ah
3 h - 4D NiCd 4.8V 4.5Ah
MODULE (battery included) / MÓDULO (incluye batería)
Module
Battery
Modulo
Batería
Model
Modelo
-KV
&KOOGPUKQPU
Dimensiones
0QOKPCN
Perfomance
Funcionamiento
nominal
1RGTCVKPI
temp.
Temp.
funcionamiento
Approvals
5GVYGKIJ
Peso conjunto
Ref. No.
Model
Modelo
LxD mm
h
ta (°C)
Kg.
FES 6-80 / 4SC / 60
9513040
4,8V 1,8 Ah NiCd
175 x 22
1
+5... +50
0,420
FES 6-80 / 4D / 180
9513050
4,8V 4,5 Ah NiCd
240 x 33
3
+5... +50
0,730
Homologaciones
BATTERIES AND HOLDERS / BATERÍA Y SOPORTE BATERÍA
Model
Modelo
Battery code
Código batería
$CVVGT[YGKIJV
Holder code
Dimensiones
Código soporte
gr
*QNFGTYGKIJV
Peso soporte
Kg.
8#J0K%F
9513041
200
9331700
0,004
8#J0K%F
9513051
500
9331701
0,011
~ Electrical protection: Class I
~ Protection rating: IP 20
~ Automatic test according EN 62034
~ Valid for DIN 0108 / EN 50172 installations
~ Suitable for cables 0,5-1,5 mm2 section stripping 7-7,5 mm.
~ The battery holders are to be ordered separately
`2QN[XCNGPVGOGTIGPE[NKIJVKPIWPKV5WKVCDNGHQTGXGT[EQPſIWTCVKQP
with every electronic or conventional ballast
~ In case of mains failure FES emergency units are designed to
EJGEMVJGHQWTRKPUQHCƀWQTGUEGPVNCORUHTQOVQ95QVJG
NCORKUEQORNGVGN[KUQNCVGFHTQODCNNCUV6JGTGKUCPCFFKVKQPCNſHVJ
pole to disconnect the mains.
~ Batteries are supplied discharged. For a functional test a 10 minutes
charge period should be enough. To obtain full performance it has
to be connected to the mains at least 48 hours.
~ These FES modules include an automatic self-diagnostic at regular
intervals. Every seven days the correct performance of the module,
the light and the battery is tested. Once per year the capacity of
the batteries is tested simulating a mains failure and making a
performance test. That is the reason why there’s only need for a
visual and periodical inspection of LED and the installation.
Approvals
Homologaciones
~ Protección eléctrica: Clase I
~ Grado de protección: IP 20
~ Autotest de acuerdo a EN 62034
~ Válido para instalaciones. DIN 0108 / EN 50172.
~ Admite cables de sección 0,5 - 1,5 mm2 con pelado 7-7,5 mm
~ Los soportes para la batería deben solicitarse separadamente
~ Unidad de iluminación de emergencia universal. Válida para
EWCNSWKGTEQPſIWTCEKÎPEQPEWCNSWKGTDCNCUVQGNGEVTÎPKEQQ
electromagnético
~ En el caso de un fallo de red, los equipos de emergencia FES
están diseñados para monitorizar los cuatro pines de una lámpara
ƀWQTGUEGPVGFGUFGC9&GHQTOCSWGNCN¶ORCTCUGCÈUNC
completamente del balasto, además posee un quinto polo para la
desconexión de su alimentación
~ Las baterías se entregan descargadas. Para una prueba funcional
RWGFGUGTUWſEKGPVGWPVKGORQFGECTICOÈPKOQFGOKPWVQU
Para obtener un rendimiento total deberá estar conectada a la red
eléctrica durante al menos 48 horas
~ Las unidades FES incorporan función de auto-diagnóstico en
intervalos regulares. Cada 7 días ponen a prueba el correcto
funcionamiento del equipo, la luz y la batería. Una vez al año la
capacidad de las baterías se mide mediante la simulación de un
fallo de alimentación, además de la prueba de funcionamiento. De
esta forma sólo es necesaria una inspección visual periódica del
estado de los LED y de la instalación.
EN 60598-2-22 Luminaires emergency lighting / Luminarias alumbrado emergencia
EN 60925 Performance / Funcionamiento
EN 61347-1 Safety (general) / Seguridad (general)
EN 61347-2-7 Safety (particular emergency) / Seguridad (particular para emergencias)
138
www.elt.es
Emergency lighting modules with self-diagnosis function
IRUWR:ÀXRUHVFHQWODPSV
Módulos para alumbrado de emergencia, con autodiagnóstico,
SDUDOiPSDUDVÀXRUHVFHQWHVGHD:
LED colour
Status
5KVWCVKQP
Color LED
Estado
Situación
Green
On
Battery charged
Correct functioning
LED
Verde
Encendido
Batería cargada
Funcionamiento correcto
White
Off > 10 mn
Mains failure
Defective FES unit
LED
Blanco
#RCICFQ OP
Fallo de red
Emergencia defectuosa
Red
Intermittent
ƀCUJKPI
Defective lamp
LED
Rojo
Parpadeo
intermitente
Fallo de la lámpara
Red
Permanently
ƀCUJKPI
Low battery capacity or battery
supply interrupted
LED
Rojo
Parpadea
continuamente
La batería tiene una capacidad
KPUWſEKGPVGQNCEQPGZKÎPFGNC
batería se encuentra abierta
MODULES VALID FOR THE FOLLOWING LAMPS / MÓDULOS VÁLIDOS PARA LAS SIGUIENTES LÁMPARAS
Lamp type
Power
Lámpara tipo
Potencia
T8
15, 18, 30, 36, 38, 58, 70 W
T5
6, 8, 13 W
T5-HE
14, 21, 28, 35 W
T5-HO
24, 39, 49, 54, 80 W
T5-C
22, 40, 55, 60 W
TC-EL
7, 9, 11 W
TC-L
18, 24, 36, 40, 55 W
TC-T
13, 18, 26, 32 W
TC-D
13, 18, 26 W
TC-DD
16, 21, 28 W
% LUMINOUS FLUX IN EMERGENCY OPERATION (at 25°C ambientent temp.)
% FLUJO LUMINOSO EN EMERGENCIA (a 25°C temp. ambiente)
Power
.WOƀWZ
Potencia
% Flujo lum.
6
54,2
18
18,1
32
10,2
36
9
54
6
58
5,6
70
4,6
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
Instructions manual on www.elt.es/productos/inst_manual.html
www.elt.es
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
Manual de instrucciones en www.elt.es/productos/manual_instrucciones.html
139
FES
220-230V
50-60Hz
Emergency lighting modules with self-diagnosis function
IRUWR:ÀXRUHVFHQWODPSV
Módulos para alumbrado de emergencia, con autodiagnóstico,
SDUDOiPSDUDVÀXRUHVFHQWHVGHD:
CONNECTION DIAGRAMS BALLAST- LAMP- MODULE
ESQUEMAS DE CONEXIÓN BALASTO/REACTANCIA A MÓDULO Y LÁMPARAS
.CORURKP
BE 236-2, BE 258-2, BE 236-3, BE 258-3, BE 236-4
1
2
3
N
Keep Wrest short
1,2
Hilos cortos
U-out <500V
L
1
BE electronic ballast
2
3
LAMP
LAMP
4
5
L
6
N
LAMP
3
4
4
5
6
Keep Wrest short 1,2
Hilos cortos
7
TWO LAMP
2
3
1
2
U-out <500V
1
2
3
.CORRKP
BE 136-2, BE 158-2, BE 136-3, BE 158-3, BE 136-4
1
BE electronic ballast
7
1
1
2
2
3
3
EMERGENCY
5
L2
6
L1
7
L
8
N
Mains
230V
50-60Hz
5
6
L2
7
L1
8
L
Battery
Battery
.CORURKP
BE 218-S, BE 236-S, BE 258-S BE 214-35-T5, BE
224-T5, BE 239-T5, BE 249-T5, BE 254-T5
U-out <500V
1
BE electronic ballast
4
LAMP
LAMP
4 5 6 7
LAMP
3
Keep Wrest short
Hilos cortos
LAMP
12,67
2
N
1 2 3
.CORURKP
BE 280-T5, BE 275-UV
1
BE electronic ballast
L
4
FES
Keep Wrest short
1,2 3,4
Hilos cortos
U-out <500V
Mains
230V
50-60Hz
EMERGENCY
4
FES
N
5
L
6
1 2 3
4 5 6
7
2
3
4
5
6
8
N
7
7
8
1
1
2
2
4
4
N
FES
N
Mains
230V
50-60Hz
5
L2
6
L1
7
Mains
230V
50-60Hz
FES
5
6
L2
7
L1
8
L
8
L
3
EMERGENCY
3
EMERGENCY
Battery
Battery
.CORURKP
BE 418-2, BE 414-2
7
.CORURKP
x 3 Lamps BE 418-2, BE 414-2
BE electronic ballast
7
8
9
10
9
10
1
2
3
LAMP
LAMP
LAMP
4
5
6
L
LAMP
N
Keep Wrest short
1,2
Hilos cortos
U-out <500V
8
1
7
2
8
3
9
1
BE electronic ballast
7
8
9
10
10
LAMP
L
LAMP
5
N
3 LAMP
2
1
2
3
LAMP
4
4 LAMP
3
4
5
6
4
5
6
6
1
1
2
EMERGENCY
4
N
5
L2
6
L1
7
L
8
Mains
230V
50-60Hz
4
N
5
L2
6
L1
7
8
L
Battery
Battery
.CORURKP
x3 Lamps BE 436-2
12
BE electronic ballast
1
11
11
Keep Wrest short
Hilos cortos 1,2,3,4
U-out <500V
2
10
3
9
8
LAMP
7
LAMP
4 5 6
LAMP
1 2 3
9
L
N
4
5
4 LAMP
1
BE electronic ballast
1 2 3
LAMP
12
4 5 6
2
8
7
LAMP
.CORURKP
BE 436-2
10
3
FES
LAMP
Mains
230V
50-60Hz
2
EMERGENCY
3
FES
LAMP
FES
220-230V
50-60Hz
L
6
1
2
EMERGENCY
3
FES
4
3
Mains
230V
50-60Hz
7
8
2
FES
5
8
1
EMERGENCY
4
6
12 11 10 9
N
7
12 11 10 9
3
3 LAMP
4
N
5
L2
6
L1
7
L
8
Mains
230V
50-60Hz
N
5
L2
6
L1
7
8
L
Battery
Battery
.COROCIPGVKE
.CORUOCIPGVKE
S
1
1
EMERGENCY
2
EMERGENCY
FES 6-80/...
S
5
N
Mains
230V
50-60Hz
4
Mains
230V
50-60Hz
6
L2
7
L1
4
N
5
L2
6
S
7
L1
8
L
8
L
2
3
3
FES6-80/...
Battery
Battery
140
www.elt.es
Capacities for power factor correction. Fluorescent lamps
Capacidades para corregir el factor de potencia.
/iPSDUDVÀXRUHVFHQWHV
220 / 230V
Power
Potencia
Lamp
(QTECRCEKV[NJ ± 0,05
Lámpara
Capacidad para NJ: 0,95 ±0,05
Model
Modelo
50Hz
μF
μF
10
TC-DD
2
1,7
16
21
TC-DD
TC-DD
2
3,5
1,7
3
28
38
TC-DD
TC-DD
4
4,5
3,5
4
4, 6, 8
5, 7, 9, 11
T
TC
2
2
1,7
1,7
13
10, 13
T
TC-D
2
2
1,7
1,7
14, 15
16
T
T
4,5
2
4
1,7
18
18
TC-D / TC-T
TC-F / TC-L
2,5
4,5
2
4
18, 20
22
T
T-R
4,5
4,5
4
4
24
25
TC-F / TC-L
T
4
3,5
3,5
3
26
30
TC-D / TC-T
T
3,5
4,5
3
4
32
36
T-R
TC-F / TC-L
4,5
4,5
4
4
36, 40
T
4,5
4
58, 65
T
7
6
70, 75
T
8
7
80
100
T
T
9
10
8
9
W
60Hz
220 / 240V
www.elt.es
141
Table of compact lamps
Tabla de lámparas compactas
Lamp type
Cap
Tipo de lámpara
GR8
GR10q
Casquillo
Power
Current
Potencia
Intensidad
W
A
Ballast type
Tipo de reactancia
TC
G23
1x5
1x7
1x9
1x11
0,180
0,175
0,170
0,160
TC
G23
2x5
2x7
2x9
0,180
0,160
0,140
TC-D
G24d-1
1x8
1x10
1x13
0,195
0,190
0,165
AC1 13/23-SP
TC-D
G24d-2
1x18
0,220
AC1 18/23-D-SC-1
TC-D
G24d-3
1x26
0,325
AC1 26/23-SC o AC1 2/23-B2-SC
TC-D/E
G24q-1
1x10
1x13
0,190
0,165
AC1 13/23-SP
TC-D/E
G24q-2
1x18
0,220
AC1 18/23-D-SC-1
and starter
y cebador
TC-D/E
G24q-3
1x26
0,325
AC1 26/23-SC
o
AC1 2/23-B2-SC
and starter
y cebador
AC1 09/23-SP
AC1 13/23-SP
and starter
y cebador
TC-T
Gx24d-2
1x18
0,220
AC1 18/23-D-SP
TC-T
Gx24d-3
1x26
0,325
AC1 26/23-SC o AC1 2/23-B2-SC
TC-TE
G24q-2
1x18
0,210
AC1 18/23-D-SC-1
and starter
y cebador
TC-TE
G24q-3
1x26
0,300
AC1 26/23-SC
o
AC1 2/23-B2-SC
and starter
y cebador
TC-S/E
2G7
1x5
1x7
1x9
1x11
0,190
0,175
0,170
0,150
AC1 09/23-SP
and starter
y cebador
TC-F
2G10
1x18
0,370
AC1 2/23-B2-SC
AC1 2/23-B2-SC
TC-F
2G10
1x24
0,300
0,345
TC-F
2G10
1x36
2x18
0,430
0,370
AC1 4/23-B2-SC
TC-L
2G11
1x18
0,370
AC1 2/23-B2-SC
TC-L
2G11
1x24
0,345
AC1 2/23-B2-SC
TC-L
2G11
1x36
2x18
0,430
0,370
AC1 4/23-B2-SC
TC-DD
GR 10q
1x10
0,180
AC1 13/23-SP
TC-DD
GR8 y GR 10q
1x16
0,200
AC1 16/23-SP
TC-DD
GR 10q
1x21
0,260
AC1 25/23-SC
TC-DD
GR8 y GR 10q
1x28
0,320
AC1 2/23-B2-SC
TC-DD
GR 10q
1x38
0,430
AC1 4/23-B2-SC
142
www.elt.es
Fluorescent lamps
.¶ORCTCUƀWQTGUEGPVGU
)GPGTCNKVKGU
Generalidades
There is a wide range of discharge lamps, all of them
based on the same operating principle.
Las lámparas de descarga incluyen un amplio abanico de
tipos, todos ellos basados en un mismo principio de funcionamiento.
The light is generated by means of a electrical discharge
between two electrodes, on the inside of a tube full of gas.
1PG QH VJGO KU VJG ƀWQTGUEGPV NCOR 6JG ƀWQTGUEGPV NCOR
comprises a glass tube with variable diameter and length depending on the power, covered on the inside with a layer of
ƀWQTGUEGPVUWDUVCPEG6JGYQNHTCOGNGEVTQFGU
QTECVJQFGU
are located on the ends of the tube, covered with an electron emitting paste. It contains low pressure argon gas and a
small amount of mercury on the inside.
These lamps, like all discharge lamps, present an impedance to the passing of the current which decreases as the
current increases, so they cannot be conneted directly to the
power mains without a device to control the intensity which
circulates through them.
La luz es generada por medio de una descarga eléctrica entre dos electrodos, en el interior de un tubo lleno de
ICU 7PC FG GNNCU GU NC N¶ORCTC ƀWQTGUEGPVG 'UVC EQPUVC
de un tubo de vidrio de diámetro y longitud variables según
la potencia, recubierto internamente de una capa de sustanEKCƀWQTGUEGPVG'PNQUGZVTGOQUFGNVWDQUGGPEWGPVTCPNQU
electrodos (ó cátodos) de wolframio, recubiertos de una pasta emisora de electrones.
Interiormente tiene gas argón a baja presión y una pequeña cantidad de mercurio. Estas lámparas, como todas las de
descarga, presentan impedancia al paso de la corriente que
disminuye a medida que esta aumenta, por lo que no pueden
ser conectadas directamente a la red de alimentación sin un
dispositivo que controle la intensidad que circula por ellas.
Este dispositivo es lo que habitualmente llamamos reactancia o también balasto y realiza las siguientes funciones:
~ Limita y regula la corriente de la lámpara.
~ Suministra las corrientes o tensiones de precalentamiento de los cátodos.
~ Para los sistemas sin cebador, proporciona la tensión
necesaria para el encendido de la lámpara.
This device is what we normally call reactance or also ballast and carries out the following functions:
~ It limits and adjusts the current of the lamp.
~ It supplies the currents or preheating voltages of the
cathodes.
~ For systems without a starter, it provides the voltage required for the lamp to light up.
In addition, a good ballast must guarantee the following:
~ Good adjustment faced with voltage variations.
~ Low heating.
~ Noiseless operation.
~ Limitation of harmonic components in the line and lamp
currents.
~ Moderate own losses so that the system works correctly.
~ Suitable dimensions.
~ Long life of the lamp.
Además, una buena reactancia debe garantizar lo siguiente:
~ Buena regulación frente a las variaciones de tensión.
~ Bajo calentamiento.
~ Funcionamiento sin ruido.
~ Limitación de componentes armónicos en las corrientes
de línea y de lámpara.
~ Pérdidas propias moderadas para lograr un buen rendimiento del sistema.
~ Dimensiones apropiadas.
~ Larga vida de la lámpara.
Each lamp has its own particular characteristics and thereHQTGPGGFUKVUURGEKſEDCNNCUV
6JGTG CTG VYQ YGNNFKHHGTGPVKCVGF ITQWRU HQT ƀWQTGUEGPV
lamps.
~ Electromagnetic ballasts where the lamp works at the
rated frequency of the line 50 or 60 Hz.
~ Electronic ballasts where the lamp works at frequencies
beetween 20-50khz.
Cada lámpara tiene unas características particulares y por
VCPVQPGEGUKVCUWDCNCUVQGURGEÈſEQ
Existen dos grupos bien diferenciados de balastos para
N¶ORCTCUƀWQTGUEGPVGU
~ Balastos electromagnéticos en los cuales la lámpara trabaja a la frecuencia nominal de la línea 50 o 60Hz.
~ Balastos electrónicos con los que la lámpara funciona a
frecuencias entre 20 - 50khz.
'NGEVTQOCIPGVKEDCNNCUVU
Balastos electromagnéticos
6[RGUQHGNGEVTQOCIPGVKEDCNNCUVU
Tipos de balastos electromagnéticos
a) According to the type of ignition:
~ Ignition by starter.
~ Ignition without starter or rapid start.
~ Instant start.
b) According to the in-line supply voltage:
~ Choke or simple impedance.
~ Leakage autotransformer.
a) Según la forma de encendido de la lámpara:
~ De arranque por cebador.
~ De arranque sin cebador o arranque rápido.
~ De arranque instantáneo.
b) Según la tensión de alimentación en línea:
~ De choque o simple impedancia.
~ De autotransformador de dispersión.
%JQMGQTUKORNGKORGFCPEGDCNNCUVU
Balastos de choque o simple impedancia
This is the most simple, economical and most usual system. It consists of an inductance connected in series to the
lamp which limits and adjusts the current.
Es el sistema más sencillo, económico y más usado. Consiste en una inductancia conectada en serie con la lámpara
que limita y regula la corriente en la misma.
www.elt.es
143
It is suitable for use in circuits where the supply voltage is
UWHſEKGPV VQ GPUWTG VJG KIPKVKQP CPF UVCDNG QRGTCVKQP QH VJG
lamp.
The line voltage must be approximately double that of the
lamp or lamps if there are two in series.
Su utilización es adecuada en circuitos donde la tensión
FG CNKOGPVCEKÎP GU UWſEKGPVG RCTC CUGIWTCT GN CTTCPSWG [
funcionamiento estable de la lámpara. La tensión de línea
debe ser aproximadamente el doble del de la lámpara o lámparas si es para dos en serie.
.GCMCIGCWVQVTCPUHQTOGTDCNNCUVU
Balastos de autotransformador de dispersión
9JGPVJGUWRRN[NKPGXQNVCIGKUPQVUWHſEKGPVHQTVJGKIPKtion and stable operation of the lamp, this type of ballast must
be used.
Cuando la tensión de la línea de alimentación no es suſEKGPVG RCTC GN CTTCPSWG [ HWPEKQPCOKGPVQ GUVCDNG FG NC
lámpara, es necesaria la utilización de estos balastos, cuyo
funcionamiento consiste en elevar la tensión para lograr el
encendido de la lámpara y regular la corriente en ésta.
Se utilizan para todos los tipos y tamaños de lámparas
pero su aplicación fundamental es para las lámparas de Alta
y Muy Alta Luminosidad (HO y VHO).
'NOKUOQſPRWGFGNQITCTUGWVKNK\CPFQWPCWVQVTCPUHQTOCdor para elevar la tensión al valor deseado y un balasto de
choque adecuado para esa tensión y lámpara a utilizar.
They operate by raising the voltage so that the lamp lights
up and the current in the lamp is regulated. They are used
for all types and sizes of lamps but they are mainly applied in
High and Very High Luminosity lamps (HO and VHO).
The same can be achieved by using an autotransformer
to raise the voltage to the desired value and suitable choke
ballast for that voltage and lamp to be used.
Autotransformador + reactancia
Autotransformer + ballast
Autotransformador de dispersión
Leakage autotransformer
E &GRGPFKPI QP VJG FGITGG QH RTQVGEVKQP KP VJG
DCNNCUV
Depending on the installation characteristics of the balNCUVU VJGUG ECP DG ENCUUKſGF CU őQT DWKNVKP WUGŒ QT őKPFGpendent”.
c) Según el grado de protección de la reactancia
Dependiendo de las características de instalación de las
TGCEVCPEKCUÃUVCURWGFGPENCUKſECTUGEQOQőCKPEQTRQTCTŒ
o “independientes”.
$CNNCUVUŎHQTDWKNVKPWUGFŏ
Reactancias “a incorporar”
These are ballasts designed to operate built in the luminaires, boxes or casing that protect them from direct contact
and from the atmosphere.
Reactancias diseñadas para funcionar incorporadas en
luminarias, cajas o envolventes que las protejan de los contactos directos y del medio ambiente.
+PFGRGPFGPVDCNNCUVU
Reactancias “independientes”
These are ballasts which can be separately assembled in
the exterior of a luminaire without additional casing. These
are manufactured with varying degrees of protection.
Reactancias que pueden montarse separadamente en el
exterior de una luminaria y sin envolvente adicional. Se fabrican con diversos grados de protección.
In order to use normal electromagnetic ballasts in exterior
lighting installations or illuminated signs, degree of protection
of the illuminated sign must be ensured to be suitable.
Para poder usar reactancias electromagnéticas normales
en instalaciones o rótulos a la intemperie, se debe asegurar
que el grado de protección del rótulo sea el adecuado.
ELT offers electromagnetic ballasts with a high degree of
RTQVGEVKQPHQTVJKUV[RGQHKPUVCNNCVKQPKPFKHſEWNVCVOQURJGTKE
conditions.
ELT ofrece reactancias electromagnéticas con alto grado
de protección para este tipo de instalaciones en duras condiciones ambientales.
F*KIJHCEVQTEQODKPGFWPKVU
d) Conjuntos en alto factor
ELT offers combined units assembled on plates, with a
JKIJRQYGTHCEVQTHQTQTƀWQTGUEGPVNCORUYJKEJKPclude the ballasts, starters, capacitors and the connection
cables to the lamps, suitable for each application.
ELT ofrece conjuntos montados en placa, con alto factor de
RQVGPEKCRCTCQN¶ORCTCUƀWQTGUEGPVGUSWGKPEQTRQTCP
las reactancias, cebadores, condensadores y cables de conexión hasta las lámparas, adecuados para cada aplicación.
144
www.elt.es
G$CNNCUVUYKVJTGFWEGFYKFVJŎ5.+/ŏ
e) Reactancias de sección reducida, “SLIM”
The reduced size of these ballasts allows them to be installed in narrow spaces where the installation of standard
ballasts is not possible.
Reactancias cuyo formato reducido permite su instalación
GPRGTſNGUGUVTGEJQUFQPFGPQGURQUKDNGNCEQNQECEKÎPFG
reactancias de formato estándar.
H$CNNCUVUYKVJKPEQTRQTCVGFVJGTOCNRTQVGEVKQP
f) Reactancias con protección térmica incorporada
Section 12.7 of regulation EN.60598-1 indicates the thermal tests that must be passed by the luminaires, semiluminaires or boxes of thermoplastic material that include lamp
control devices.
La norma EN 60598-1 en su apartado 12.7 indica los ensayos térmicos con los que deben cumplir las luminarias,
semiluminarias o cajas de material termoplástico que incorporan dispositivos de control de lámparas.
The following measures can be adopted to ensure compliance:
Para asegurar el cumplimiento se pueden adoptar las siguientes medidas:
~ Constructive measures: using temperature resistant
Stands (usually metallic) that maintain the components
in position even in the case of a breakdown or fault.
~ Medidas constructivas: utilizando soportes resistentes a
la temperatura (normalmente metálicos) que mantengan
los componentes en su posición incluso en el caso de
avería o fallo de éstos.
~ Protection measures in the control devices: the use of
lamp control devices with suitable thermal protection.
~ Medidas de protección en los dispositivos de control:
utilizando dispositivos de control de lámpara con protección térmica adecuada.
/CTMUCPFKPFKECVKQPU
Marcas e indicaciones
Apart from the electrical features, a series of indications
are printed on the ballasts, which should be studied in order to use them correctly, thus obtaining maximum electric,
safety and duration possibilities.
Los balastos, además de las características eléctricas,
llevan impresas una serie de indicaciones que conviene conocer para hacer el uso adecuado de los mismos, obteniéndose así las máximas prestaciones eléctricas, de seguridad
y duración.
Tw
Tw
This is the maximum temperature at which the ballast windings can operate constantly under normal
conditions, at their rated voltage and frequency, to
ensure an average life of 10 years. Any increases
or decreases in the temperature of the windings affect their life span, as shown in the enclosed chart.
Es la temperatura máxima a la cual pueden funcionar constantemente los bobinados de un balasto en
condiciones normales, a su tensión y frecuencia nominales, para asegurar una vida media de 10 años.
Los aumentos o disminuciones de la temperatura
FGNQUDQDKPCFQUVKGPGPWPCKPƀWGPEKCGPNCXKFCFG
NQUOKUOQUUGIÕPUGTGƀGLCGPGNIT¶ſEQCFLWPVQ
100
50
Años de
vida
Life
years
20
10
tw 130
5
2,5
tw 120
80
90
100
110
Operating temperature
120
130
140°C
Temperaturas en los arrollamientos
ţV
*
GCVKPI QH VJG YKPFKPIU QH C DCNNCUV QXGT VJG CObient temperature where it is installed, operating
under normal conditions and at rated voltage and
frequency.
ţV
%
CNGPVCOKGPVQ FG NQU DQDKPCFQU FG WP DCNCUVQ
sobre la temperatura ambiente en la que está instalado, funcionando en condiciones normales y a
tensión y frecuencia nominales.
ta
Maximum ambient temperature at which a ballast
can be operated under normal conditions.
6JKUKUFGVGTOKPGFD[VYŌţVVC
'ZCORNGVYţVVCu%
ta
Temperatura de ambiente máxima a la que puede
funcionar un balasto en condiciones normales.
8KGPGFGVGTOKPCFCRQTVYŌţVVC
'LGORNQVYţVVCu%
ţVECR
GCVKPI KP ECRCEKVKXG QRGTCVKQP UGTKGU ECRCEKVQT
*
under normal conditions.
ţVECR
%
CNGPVCOKGPVQ GP TÃIKOGP ECRCEKVKXQ EQPFGPUCdor en serie) en condiciones normales.
ţVCP
GCVKPI QH VJG YKPFKPIU OGCUWTGF KP CDPQTOCN
*
operation (for example with the starter on shortcircuit) and supplied at 1.1 times its rated voltage.
ţVCP
%
CNGPVCOKGPVQ FG NQU DQDKPCFQU OGFKFQU GP HWPcionamiento anormal (por ejemplo con el cebador
en cortocircuito) y alimentado a 1,1 veces su tensión nominal.
Losses
Self-consumed power. If no other way is indicated,
this value is measured with rated voltage and frequency and with the windings at a temperature of
25°C.
Pérdidas Potencia autoconsumida. Si no se indica otra forma, este valor está medido con voltaje y frecuencia
nominales y con los bobinados a una temperatura
de 25°C.
www.elt.es
145
NJ
Power Factor is obtained by the following formula:
Line power
NJ = ................................................................
Line voltage x Line current
NJ
Factor de potencia, se obtiene por la siguiente fórmula:
Potencia en línea
NJ = .................................................................
Tensión de línea x Corriente de línea
Self-certifying mark which indicates conformity with the
European Directives LV and EMC.
/
CTECFGCWVQEGTVKſECEKÎPSWGFGENCTCNCEQPHQTOKFCF
con las Directivas Europeas LV y EMC.
/CPWHCEVWTKPIUVCPFCTFU
Normas de fabricación
'.6ŏU GNGEVTQOCIPGVKE DCNNCUVU HQT ƀWQTGUEGPV NCORU CTG
manufactured in accordance with the following standards:
Las normas según las cuales están fabricadas las reacVCPEKCUGNGEVTQOCIPÃVKECUFG'.6RCTCN¶ORCTCUƀWQTGUcentes son:
EN 61347-1
Auxiliary equipment for lamps, Part 1:
General and security requirements.
EN 61347-1
Aparatos auxiliares para lámparas. Parte
1: requisitos generales y de seguridad.
EN 61347-2-3
Particular requirements for AC supplied
GNGEVTQPKEDCNNCUVUHQTƀWQTGUEGPVNCORU
EN 61347-2-3
Requisitos particulares para balastos
electronicos alimentados en corriente
CNVGTPCRCTCNCORCTCUƀWQTGUEGPVGU
EN 61347-2-8
'0
Particular requirements for ballasts for
ƀWQTGUEGPVNCORU
EN 61347-2-8
'0
Prescripciones particulares para balasVQURCTCN¶ORCTCUƀWQTGUEGPVGU
'0
$CNNCUVU HQT VWDWNCT ƀWQTGUEGPV NCORU
Operation requirements.
'0
$CNCUVQURCTCN¶ORCTCUƀWQTGUEGPVGU
tubulares. Prescripciones de funcionamiento.
#05+%
5RGEKſECVKQPUHQTƀWQTGUEGPVNCORU
#05+%
'
URGEKſECEKQPGURCTCN¶ORCTCUƀWQTGUcentes.
ANSI C 78
Physical and electrical characteristics for
ƀWQTGUEGPVNCORU
ANSI C 78
Características físicas y eléctricas para
N¶ORCTCUƀWQTGUEGPVGU
'0
6WDWNCT ƀWQTGUEGPV NCORU HQT IGPGTCN
lighting.
'0
.¶ORCTCUVWDWNCTGUƀWQTGUEGPVGURCTC
iluminación general.
'0
5KPING ECR ƀWQTGUEGPV NCORU 5GEWTKV[
and operating requirements.
'0
.¶ORCTCUƀWQTGUEGPVGUFGECUSWKNNQ
único. Prescripciones de seguridad y
funcionamiento.
EN 55015
Limits and measuring methods of the
relative characteristics of radio electrical
disturbance of lighting and similar devices.
EN 55015
Límites y métodos de medida de las
características relativas a la perturbación
radioeléctrica de los equipos de iluminación y similares.
EN 61000-3-2
Electromagnetic compatibility (CEM).
Part 3: Limits
Section 2: Limits for the harmonic current
emissions (equipment with an input current equal to or less than 16A per phase).
EN 61000-3-2
Compatibilidad electromagnetica (CEM).
Parte 3: Límites.
Sección 2: Límites para las emisiones de
corriente armónica (equipos con corriente de entrada menor o igual que 16 A
por fase).
EN 61547
Equipment for general lighting use. Immunity requirements-EMC.
EN 61547
Equipos para alumbrado de uso general.
Requisitos de inmunidad - CEM.
EN 50294
Method of measuring the total input power in the ballast-lamp circuit.
EN 50294
Método de medida de la potencia total
de entrada de los circuitos balasto-lámpara.
6JGVGUVUVQGPUWTGVJGHWNſNOGPVQHVJGCRRNKECDNGTGIWNCtions for the emissions of radio-interference, harmonics and
immunity are carried out on the equipment made up of the
ballast, lamp, luminaire and wiring.
Los ensayos para el cumplimiento con las normativas
aplicables de emisión de radio-interferencias, armónicos e
inmunidad, deben ser realizados al conjunto formado por
reactancia, lámpara, luminaria y cableado.
+PUVCNNCVKQPTGEQOOGPFCVKQPU
Recomendaciones de instalación
6QQDVCKPCUCHGGHſEKGPVCPFNCUVKPIKPUVCNNCVKQPCUYGNN
as optimum operation and lifetime in the lamps with electromagnetic ballasts, the following recommendations should be
taken into consideration.
2CTCNQITCTWPCKPUVCNCEKÎPUGIWTCGſEC\[FWTCFGTCCUÈ
como el funcionamiento y vida óptimos de las lámparas con
reactancias electromagnéticas, se deben tener en cuenta
las siguientes recomendaciones:
$CNNCUVCUUGODN[
Montaje de la reactancia
Assemble the ballasts as far away from each other and
from the lamps as possible to avoid excessive heating.
Montar las reactancias lo mas separadas posibles entre
si y de las lámparas para evitar excesivos calentamientos.
146
www.elt.es
Ensure that the ballast is in contact with the surface of the
luminaire to achieve good heat transmission.
#UGIWTCTGNEQPVCEVQFGNCTGCEVCPEKCEQPNCUWRGTſEKGFG
la luminaria para conseguir una buena transmisión de calor.
(KZVJGDCNNCUVUVQVJGNWOKPCKTGWUKPICNNKVUſZKPIRQKPVUCV
a minimum distance of 3mm from the side of the luminaire to
minimize the vibration generated by the dispersed magnetic
ſGNFCPFVQCXQKFPQKUG
(KLCT NCU TGCEVCPEKCU C NC NWOKPCTKC ſTOGOGPVG WVKNK\CPFQ
todos sus puntos de anclaje a una distancia mínima de 3
mm. del lateral de la luminaria para minimizar la vibración
generada por el campo magnético disperso y evitar ruidos.
Vibrations depend a lot on the luminaires, and so these
must be solidly built and if necessary, nerves or piping should
be planned to avoid the spread of the vibrations.
Las vibraciones dependen mucho de las luminarias, por lo
que éstas deben ser de construcción sólida y prever, si fuera
necesario, nervios o acanaladuras, para evitar la propagación de las vibraciones.
9KTKPI
Cableado
Carry out the wiring according to the diagram marked by
the manufacturer on the ballast.
Realizar el cableado según al esquema eléctrico marcado
por el fabricante sobre la reactancia.
6QEQPPGEVYKVJCSWKEMENCORWUGTKIKFEQRRGTQTOWNVKſlar wire with a section of between 0.5 and 1mm2 .
2CTCEQPGZKÎPEQPſEJCT¶RKFCWVKNK\CTJKNQFGEQDTGTÈIKFQ
de sección entre 0.5 y 1 mm2.
6QEQPPGEVYKVJCUETGYENCORWUGTKIKFEQRRGTQTOWNVKſlar wire with a maximum section of 2.5mm2.
2CTCEQPGZKÎPEQPſEJCVQTPKNNQWVKNK\CTECDNGFGEQDTGTÈIKFQQOWNVKſNCTFGWPCUGEEKÎPO¶ZKOCFGOO
It is advisable to use a pitching tool in the case of using
OWNVKſNCTEQPFWEVQTU
'PGNECUQFGWVKNK\CTEQPFWEVQTGUOWNVKſNCTGUGUCEQPUGjable usar punterolas.
Respect the length of stripped cable, usually between 8
and 10 mm.
Respetar la longitud de pelado de los cables normalmente
entre 8 y 10 mm.
Input Voltage
Tensión de alimentación
The connection must always be carried out without voltage.
Se deben realizar siempre las conexiones en ausencia de
tensión.
Before switching on the installation, check that the input
voltage and frequency correspond to that marked on the ballast.
#PVGUFGNCRWGUVCGPOCTEJCFGNCKPUVCNCEKÎPXGTKſECT
que la tensión y frecuencia de alimentación corresponden
con la marcada en la reactancia.
ELT’s ballasts con operate with the nominal indicated voltage with a tolerance of +/-5%. For larger deviations it is necessary to use adequate nominal voltage ballasts otherwise
the life of the lamp could be shortened.
Las reactancias de ELT pueden funcionar a la tensión nominal indicada con una tolerancia de +/-5%. Para desviaciones superiores es necesario utilizar reactancias de tensión
nominal adecuada, de lo contrario se acortará la vida de la
lámpara.
The indicated polarity must be respected. In three-phase
installations to 400V, the neutral must always be connected.
If it is interrupted there could exist the possibility of a breakdown.
Se debe respetar la polaridad indicada. En instalaciones
trifásicas a 400V, se debe asegurar que el neutro esté siempre conectado, si quedara interrumpido, podría existir riesgo
de avería.
'CTVJ9KTG
Conductor de tierra
For electrical security and to favour ignition, connect the
ballast and the metallic parts of the luminaire to the earth
wire.
Conectar la reactancia y las partes metálicas de la luminaria al conductor de tierra, por seguridad eléctrica y para
favorecer el encendido.
%CRCEKVQTU
Condensadores
The power factor correction capacitor must be of the capacity and voltage recommended by the manufacturer of the
ballast.
El condensador de corrección del factor de potencia debe
ser de la capacidad y tensión recomendadas por el fabricante de la reactancia.
Starters
Cebadores
To correctly choose a starter, the input voltage and the
power of the lamp in which they will be used, as well as if
one or two lamps will be installed in series, must be taken
into account.
Para la correcta elección del cebador se debe tener en
cuenta la tensión de red y potencia de lámpara para las cuales van a ser empleados, así como si se instala una, o dos
lámparas en serie.
Lamps
Lámparas
The electromagnetic ballasts have been designed to operate in certain lamps. The total compatibility between the
lamps and ballasts must be ensured.
Las reactancias electromagnéticas han sido diseñadas
para funcionar con unas lámparas determinadas. Se deberá
asegurar la completa compatibilidad entre las lámparas y las
reactancias.
www.elt.es
147
1RGTCVKPICVOQURJGTG
Ambiente de funcionamiento
The temperature and humidity in the atmosphere in which
the electromagnetic ballast is installed is of vital importance
to its correct operation and life length. The temperatures
reached by each of the components reach must be checked
to ensure they do not exceed the limits indicated for each of
them.
La temperatura y la humedad ambiente en la que se encuentra colocada la reactancia electromagnética, es de vital
KORQTVCPEKCRCTCUWHWPEKQPCOKGPVQ[FWTCEKÎP8GTKſECTSWG
las temperaturas alcanzadas por los componentes no sobrepasan los límites indicados para cada uno de ellos.
Se debe asegurar un grado de protección adecuado contra la humedad.
A correct degree of protection against humidity must be
ensured.
/CKPVGPCPEG
Mantenimiento
All maintenance and replacement operations must be carried out while the equipment is disconnected from the mains.
6JGUGQRGTCVKQPUOWUVDGECTTKGFQWVD[SWCNKſGFRGTUQPPGN
and the instructions and current regulations must be strictly
followed.
Todas las operaciones de mantenimiento y reposición de
componentes siempre deben ser realizadas desconectando
NQUGSWKRQUFGNCTGFUKGORTGRQTRGTUQPCNEWCNKſECFQUKguiendo rigurosamente las instrucciones dadas sobre el producto y la reglamentación vigente.
2TQVGEVKQP
Protecciones
Adequate measures of protection against short-circuits,
leakage currents and shunts (differentials) should be provided.
Colocar en los circuitos los medios de protección adecuados contra cortocircuitos (fusibles, interruptores magnetotérmicos) y contra corrientes de fuga y derivaciones a masa
(diferenciales).
Use ballasts with thermal protection where high temperaVWTGUUWRRQUGCſTGTKUM
DCNNCUVUOCFGHTQORNCUVKEQTKPƀCOmable material). See regulation EN 60598-1. Section 12.7.
Utilizar reactancias con protección térmica donde las altas
temperaturas puedan suponer un riesgo de incendio (luminarias de plástico o material combustible). Ver norma EN
60598-1. Apdo. 12.7.
4CRKFKIPKVKQPKPUVCNNCVKQPU
Instalaciones de arranque rápido
For the correct operation of rapid ignition installations a
series of conditions are required:
Para un funcionamiento correcto de las instalaciones de
arranque rápido se requieren, además, una serie de condiciones:
~ The mains voltage must be higher than 90% of the nominal.
~ La tensión de red debe ser mayor del 90% de la nominal.
~ The polarity for mains tension indicated on the ballast
must be respected.
~ Respetar la polaridad indicada en la reactancia para la
tensión de red.
~ Incorporate ignition help, at least 25 mm. of the tubes
and connect to the earth wire, to favour ignition.
~ Incorporar ayudas al arranque, a menos de 25 mm. de
los tubos y conectadas a tierra, para favorecer el encendido.
~ Avoid centralizing ballasts. In the case that ballasts are
required to be centralized, they should be manufactured
upon request. The resistance of each pair of wires from
each cathode should not exceed 0.5 ohms for normal
ballasts in series.
~ Evitar las centralizaciones de las reactancias. En caso
de que se quiera centralizarlas, se deberán fabricar bajo
pedido. La resistencia de cada pareja de hilos de cada
E¶VQFQPQFGDGUQDTGRCUCTNQUšRCTCNCUTGCEVCPEKCU
normales de serie.
~ Rapid ignition ballasts are not valid for T8 tubes of 26
~ Las reactancias de arranque rápido no son válidas para
tubos T8 de 26 mm. de diámetro.
mm. diameter.
148
www.elt.es
'PGTI[GHſEKGPE[TGSWKTGOGPVUHQTDCNNCUVU
HQTƀWQTGUEGPVNKIJVKPI
4GSWKUKVQUFGGſEKGPEKCGPGTIÃVKECFGNQU
Componentes para lámparas Fluorescentes
Commission Regulation of 18 March 2009 (EC) No.
245/2009 amended by the Commission Regulation of 21 April
2010 (EC) No. 347/2010 setting ecodesign requirements for
ƀWQTGUEGPVNCORUYKVJQWVKPVGITCVGFDCNNCUVHQTJKIJKPVGPUKV[
discharge lamps, and for ballasts and luminaires able to operate such lamps, and repealing Directive 2000/55/EC.
El Reglamento 245/2009 de 18 de marzo de 2009, corregido por el Reglamento 347/2010 de 21 abril 2010 es el
que implementa la Directiva 2005/32/CE del Consejo y del
Parlamento Europeo, en relación a los requisitos de diseño
ecológico para lámparas de alta intensidad de descarga, de
balastos y de luminarias. Esta Directiva sustituye a la anterior 2000/55/CE.
These Regulations are both implementing the Directive
2009/125/EC establishing a framework for the setting of
ecodesign requirements for energy related products.
Dichos Reglamentos implementan la Directiva 2009/125/
CE que instaura un marco para el establecimiento de requisitos de diseño ecológico aplicables a los productos relacionados con la energía.
6JGFKHHGTGPEGKUVJCVVJG''+
'PGTI['HſEKGPE[+PFGZKU
not based on the system power (as it was in the “Ballast DiTGEVKXGŒDWVQPVJGDCNNCUVGHſEKGPE[UQNCORRQYGTFKXKFGF
by system power. The measurement methods follows IEC
62442-1.
En la primera etapa (13.04.2010) los requisitos fuerón
KFÃPVKEQU RCTC NQU DCNCUVQU RCTC N¶ORCTCU ƀWQTGUEGPVGU
sólo se realizo una transformación de “la potencia del sisVGOCŒGPőGſEKGPEKCFGNDCNCUVQŒ.QUOÃVQFQUFGOGFKEKÎP
siguen siendo los mismos según IEC 62442-1.
(KTUV5VCIG
Ō[GCTCHVGTGPVT[
KPVQHQTEG
Etapa 1 (13.04.2010) - un año después de que el
Reglamento entró en vigor:
The requirements are equal to the ones from the Directive
2000/55/EC
4GSWKUKVQUKFÃPVKEQUCNQUFGſPKFQUGPNCCPVGTKQT&KTGEVKXC
2000/55/CE
~ Standard ballasts mínimum EEI=B2
~ Dimmable ballasts EEI=A1
~ Standby losses <= 1 W
~ For new lamps not designed for current ballasts the efſEKGPE[TGSWKTGOGPVUHQTDCNNCUVUCTG''+#
~ EEI Marking requirements for ballasts mandatory.
~ Balastos no dimables mínimo EEI=B2
~ Balastos dimables EEI=A1
~ Pérdidas en Stanby <= 1W
~ Balastos no dimables para nuevas lámparas para los
que no existían balastos EEI=A3.
~ Los balastos deben llevar marcado el EEI
5VCIG
Ō[GCTUCHVGTGPVT[
KPVQHQTEG
Etapa 2 (13.04.2012) - tres años después de que el
Reglamento entró en vigor:
~ Standby losses <=0.5W
~ Pérdidas en Stanby <= 0,5W
5VCIG
[GCTUCHVGTGPVT[KPVQHQTEG
Etapa 3 (13.04.2017) - ocho años después de que el
Reglamento entre en vigor:
~ New ballast limit value formula where:
~ Los límites de los nuevos balastos se
ECNEWNCPUGIÕPNCHÎTOWNCGURGEKſECFC
- EBb FL = 0 .71
for P lamp ”:
Plamp ( in Watt )
- EBb FL =
2
Balasto
Ballast
IRU:Plamp 100 :
1 P
38 P ( in Watt )
lamp ( in Watt ) +
lamp
+1
36
dž
36
- EBb FL = 0 .91
The following picture shows the
differencies between the different
indexes:
The CE marking on the ballast
states the conformity of the ballasts to the requirements of the
245/2009 Regulation
for P lamp ”:
Ů'$DFL
A2 / A1BAT
Ů
'$DFL)
A2BAT
.CUKIWKGPVGIT¶ſECKNWUVTCNCUFKferencias entre los distintos índices:
A2 / A1 BAT
Ballast
PFKEGFG'ſEKGPEKC'PGTIÃVKEC
'PGTI['HſEKGPE[+PFGZ
A2 BAT
0,95
El marcado CE sobre balasto,
EQPUVKVW[G NC EQPſTOCEKÎP RQT
parte del fabricante de que el balasto se ajusta a los requisitos del
Reglamento 245/2009.
0,90
0,85
0,80
0,75
0,70
0
For more information:
20
40
60
80
100
120
3ODPS (:)
http://celma.org/archives/temp/CELMA_EcoDesign_(SM)258_CELMA_ELC_Tertiary_Lighting_Guide_2nd_Edition_FINAL_December2010.pdf
Para más información:
JVVRYYYGſNWOGUFQEWOGPVQU%'./#AIWKCACRNKECEKQPRFH
www.elt.es
149
Tipo de lámpara
T8
TC-L
TC-F
T
TC-D
TC-DE
TC-T
TC-TE
TC-DD
TC-DDE
GR10q
6[RKECNTCVKPI
ILCOS - Code
$CNNCUVGHſEKGPE[
PQPFKOOCDNGDCNNCUV
2.COR2KPRWV
Potencia nominal
W
Lamp type
0QOKPCNQWVRWV
Potencia nominal
7DEOHRIEDOODVWVODPSVFLUFXLWFODVVL¿FDWLRQ
7DEODSDUDODFODVL¿FDFLyQGHOFRQMXQWREDODVWROiPSDUD
Código ILCOS
'ſEKGPEKCFGNDCNCUVQ
PQTGIWNCDNG
50 Hz
HF
A2 BAT
A2
A3
B1
W
W
%
%
%
%
B2
%
15
FD-15-E-G13-26/450
15
13,5
87,8
84,4
75,0
67,9
62,0
18
FD-18-E-G13-26/600
18
16
87,8
84,2
76,2
71,3
65,8
30
FD-30-E-G13-26/900
30
24
82,1
77,4
72,7
79,2
75,0
36
FD-36-E-G13-26/1200
36
32
91,4
88,9
84,2
83,4
79,5
38
FD-38-E-G13-26/1050
38,5
32
87,7
84,2
80,0
84,1
80,4
58
FD-58-E-G13-26/1500
58
50
93,0
90,9
84,70
86,1
82,2
70
FD-70-E-G13-26/1800
69,5
60
90,9
88,2
83,3
86,3
83,1
18
FSD-18-E-2G11
18
16
87,7
84,2
76,2
71,3
65,8
24
FSD-24-E-2G11
24
22
90,7
88,0
81,5
76,0
71,3
36
FSD-36-E-2G11
36
32
91,4
88,9
84,2
83,4
79,5
18
FSS-18-E-2G10
18
16
87,7
84,2
76,2
71,3
65,8
24
FSS-24-E-2G10
24
22
90,7
88,0
81,5
76,0
71,3
36
FSS-36-E-2G10
36
32
91,4
88,9
84,2
83,4
79,5
10
FSQ-10-E-G24q=1
FSQ-10-I-G24d=1
10
9,5
89,4
86,4
73,1
67,9
59,4
13
FSQ-13-E-G24q=1
FSQ-13-I-G24d=1
13
12,5
91,7
89,3
78,1
72,6
65,0
18
FSQ-18-E-G24q=2
FSQ-18-I-G24d=2
18
16,5
89,8
86,8
78,6
71,3
65,8
26
FSQ-26-E-G24q=3
FSQ-26-I-G24d=3
26
24
91,4
88,9
82,8
77,2
72,6
13
FSM-13-E-GX24q=1
FSM-13-I-GX24d=1
13
12,5
91,7
89,3
78,1
72,6
65,0
18
FSM-18-E-GX24q=2
FSM-18-I-GX24d=2
18
16,5
89,8
86,8
78,6
71,3
65,8
26
FSM-26-E-GX24q=3
FSM-26-I-GX24d=3
26,5
24
91,4
88,9
82,8
77,5
73,0
10
FSS-10-E-GR10q
FSS-10-L/P/H-GR10q
10,5
9,5
86,4
82,6
70,4
68,8
60,5
16
FSS-16-E-GR10q
FSS-16-I-GR10q
FSS-10-L/P/H-GR10q
16
15
87,0
83,3
75,0
72,4
66,1
21
FSS-21-E-GR10q
FSS-21-I-GR10q
FSS-21-L/P/H-GR10q
21
19
89,4
86,4
79,2
73,9
68,8
28
FSS-28-E-GR10q
FSS-28-I-GR10q
FSS-28-L/P/H-GR10q
28
26
89,7
86,7
81,3
78,2
73,9
38
FSS-38-E-GR10q
FSS-38-L/P/H-GR10q
38,5
36
92,3
90,0
85,7
84,1
80,4
5
FSD-5-I-G23 FSD-5-E-2G7
5,4
5
72,7
66,7
58,8
49,3
41,4
7
FSD-7-I-G23 FSD-7-E-2G7
7,1
6,5
77,6
72,2
65,0
55,7
47,8
9
FSD-9-I-G23 FSD-9-E-2G7
8,7
8
78,0
72,7
66,7
60,3
52,6
11
FSD-11-I-G23 FSD-11-E-2G7
11,8
11
83,0
78,6
73,3
66,7
59,6
4
FD-4-E-G5-16/150
4,5
3,6
64,9
58,1
50,0
45,0
37,2
6
FD-6-E-G5-16/225
6
5,4
71,3
65,1
58,1
51,8
43,8
TC
T5
T9-C
8
FD-8-E-G5-16/300
7,1
7,5
69,9
63,6
58,6
58,6
42,7
13
FD-13-E-G5-16/525
13
12,8
84,2
80,0
75,3
75,3
65,0
22
FSC-22-E-G10q-29/200
22
19
89,4
86,4
79,2
74,6
69,7
32
FSC-32-E-G10q-29/300
32
30
88,9
85,7
81,1
80,0
76,0
40
FSC-40-E-G10q-29/400
40
32
89,5
86,5
82,1
82,6
79,2
150
www.elt.es
Tipo de lámpara
T5-E
T5-C
TC-LE
TC-TE
TC-DD
www.elt.es
GR10q
6[RKECNTCVKPI
ILCOS - Code
W
Lamp type
0QOKPCNQWVRWV
Potencia nominal
7DEOHRIEDOODVWVODPSVFLUFXLWFODVVL¿FDWLRQ
7DEODSDUDODFODVL¿FDFLyQGHOFRQMXQWREDODVWROiPSDUD
Código ILCOS
$CNNCUVGHſEKGPE[
PQPFKOOCDNGDCNNCUV
2.COR2KPRWV
Potencia nominal
'ſEKGPEKCFGNDCNCUVQ
PQTGIWNCDNG
50 Hz
HF
A2 BAT
A2
A3
B1
B2
W
W
%
%
%
%
%
14
FDH-14-G5-L/P-16/550
-
13,7
84,7
80,6
72,1
-
-
21
FDH-21-G5-L/P-16/850
-
20,7
89,3
86,3
79,6
-
-
24
FDH-24-G5-L/P-16/550
-
22,5
89,6
86,5
80,4
-
-
28
FDH-28-G5-L/P-16/1150
-
27,8
89,8
86,9
81,8
-
-
35
FDH-35-G5-L/P-16/1450
-
34,7
91,5
89,0
82,6
-
-
39
FDH-39-G5-L/P-16/850
-
38,0
91,0
88,4
82,6
-
-
49
FDH-49-G5-L/P-16/1450
-
49,3
91,6
89,2
84,6
-
-
54
FDH-54-G5-L/P-16/1150
-
53,8
92,0
89,7
85,4
-
-
80
FDH-80-G5-L/P-16/1150
-
80,0
93,0
90,9
87,0
-
-
95
FDH-95-G5-L/P-16/1150
-
95,0
92,7
90,5
84,1
-
-
120
FDH-120-G5-L/P-16/1450
-
120,0
92,5
90,2
84,5
-
-
22
FSCH-22-L/P-2GX13-16/225
-
22,3
88,1
84,8
78,8
-
-
40
FSCH-40-L/P-2GX13-16/300
-
39,9
91,4
88,9
83,3
-
-
55
FSCH-55-L/P-2GX13-16/300
-
55,0
92,4
90,2
84,6
-
-
60
FSCH-60-L/P-2GX13-16/375
-
60,0
93,0
90,9
85,7
-
-
40
FSDH-40-L/P-2G11
-
40,0
91,4
88,9
83,3
-
-
55
FSDH-55-L/P-2G11
-
55,0
92,4
90,2
84,6
-
-
80
FSDH-80-L/P-2G11
-
80,0
93,0
90,9
87,0
-
-
32
FSMH-32-L/P-2GX24q=3
-
32,0
91,4
88,9
82,1
-
-
42
FSMH-42-L/P-2GX24q=4
-
43,0
93,5
91,5
86,0
-
-
57
FSM6H-57-L/P-2GX24q=5
FSM8H-57-L/P-2GX24q=5
-
56,0
91,4
88,9
83,6
-
-
70
FSM6H-70-L/P-2GX24q=6
FSM8H-70-L/P-2GX24q=6
-
70,0
93,0
90,9
85,4
-
-
60
FSM6H-60-L/P-2G8=1
-
63,0
92,3
90,0
84,0
-
-
62
FSM8H-62-L/P-2G8=2
-
62,0
92,2
89,9
83,8
-
-
82
FSM8H-82-L/P-2G8=2
-
82,0
92,4
90,1
83,7
-
-
85
FSM6H-85-L/P-2G8=1
-
87,0
92,8
90,6
84,5
-
-
120
FSM6H-120-L/P-2G8=1
FSM8H-120-L/P-2G8=1
-
122,0
92,6
90,4
84,7
-
-
55
FSSH-55-L/ P-GR10q
-
55,0
92,4
90,2
84,6
-
-
151
'NGEVTQPKEDCNNCUVU
Balastos electrónicos
6JGJKIJHTGSWGPE[GNGEVTQPKEDCNNCUVU
El balasto de alta frecuencia
The impedance that discharge lamps possess decreases
as the current that passes through the lamp increases, which
means that they cannot be connected to the mains supply
without devices which control the intensity of the current
YJKEJƀQYUVJTQWIJVJGO
Las lámparas de descarga poseen una impedancia al
paso de la corriente que disminuye a medida que esta aumenta, por lo que no pueden ser conectadas directamente a
la red de alimentación sin dispositivos que controlen la intensidad de corriente que circule por ellas.
These devices are called ballasts and must ensure that the
lamps operate correctly, carrying out the following functions:
Estos dispositivos se denominan reactancia o balasto y
deben asegurar un correcto funcionamiento de las lámparas,
realizando las siguientes funciones:
~ To supply the heating cathode current.
~ To provide the voltage necessary to start the lamp.
`6QNKOKVVJGEWTTGPVYJKEJƀQYUVJTQWIJVJGNCORU
These functions can be carried out both by electromagnetic ballasts, and by electronic ballasts.
~ Suministrar la corriente de calentamiento de los cátodos.
~ Proporcionar la tensión necesaria para el encendido de
la lámpara.
~ Limitar la corriente que circula por las lámparas.
Estas funciones pueden ser realizadas tanto por reactancias electromagnéticas como por balastos electrónicos.
'NGEVTQOCIPGVKEDCNNCUVU
Reactancias electromagnéticas
These are inductive impedances made up of copper wire
coils and iron cores. They require an external start device,
a starter and a capacitor to compensate the reactive power.
Son impedancias inductivas compuestas por bobinas de
hilo de cobre y núcleos de hierro, que requieren de un dispositivo externo de encendido, un cebador, y un condensador
para compensar la potencia reactiva.
'NGEVTQPKEDCNNCUVU
Balastos electrónicos
Electronic ballasts are a high frequency supply system for
ƀWQTGUEGPVNCORUYJKEJUWDUVKVWVGUVJGEQPXGPVKQPCNU[UVGO
made up of a electromagnetic ballast, a starter and a capacitor for high power factor.
Los balastos electrónicos constituyen un sistema de aliOGPVCEKÎP GP CNVC HTGEWGPEKC RCTC N¶ORCTCU ƀWQTGUEGPVGU
sustitutivo de la instalación convencional compuesta de
reactancia electromagnética, cebador y condensador para
alto factor de potencia.
This system consists of a printed circuit board with electronic components that makes the lamps work at frequencies over 20kHz, while lamps work at net standard frequency
(e.g. 50Hz in Europe) with electromagnetic ballasts.
Este sistema consiste en un circuito impreso con componentes electrónicos que hacen trabajar a las lámparas a
frecuencias por encima de 20kHz, a diferencia de las reactancias convencionales en las que las lámparas trabajan a la
frecuencia de red (p.e. 50Hz en Europa).
'NGEVTQPKEDCNNCUVU
EJCTCEVGTKUVKEU
Características de los balastos
electrónicos
*KIJHTGSWGPE[QRGTCVKQP
Funcionamiento en alta frecuencia
The main characteristic of the electronic ballasts is the
high frequency operation of the lamps.
La principal característica de los balastos electrónicos es
el funcionamiento en alta frecuencia de las lámparas.
$[OCMKPIƀWQTGUEGPVNCORUYQTMYKVJHTGSWGPEKGUJKIJGT
VJCP-*\VJGNWOKPQWUƀWZQDVCKPGFHQTVJGUCOGRQYGT
in the lamp is up to 10% greater than that obtained with 50Hz.
*CEKGPFQVTCDCLCTCNCUN¶ORCTCUƀWQTGUEGPVGUCHTGEWGPEKCUUWRGTKQTGUC-*\GNƀWLQNWOKPQUQQDVGPKFQRCTCNC
misma potencia en lámpara, es hasta un 10% mayor que el
obtenido con 50Hz.
Operating with frequencies higher than 50 KHz does not
TGUWNV KP C UKIPKſECPV KORTQXGOGPV KP VJG KPETGCUG QH NKIJV
GHſEKGPE[
Trabajar a frecuencias superiores a 50KHz no supone una
OGLQTCUKIPKſECVKXCGPGNCWOGPVQFGNCGſECEKCNWOKPQUC
Thanks to this be- Ø lum. %
haviour, high frequen110
cy ballasts reduce
the current and also
105
the power in the lamp
needed to obtain the
UCOGƀQYCUCEJKGXGF
100
with 50Hz.
Gracias a este comportamiento, los balastos de alta frecuencia
reducen la corriente
en la lámpara, y por
tanto la potencia en la
misma, para obtener
GNOKUOQƀWLQSWGEQP
50Hz.
Hz
50 100
1000
152
10000
50000
www.elt.es
*KIJFGITGGQHEQOHQTV
Alto grado de confort
Absence of stroboscopic effect
As a result of the use of alternative current in the mains
supply, the lamp’s intensity passes zero twice per period thus
decreasing the luminous intensity to almost zero in those moOGPVU 6JKU ECWUGU C ƀKEMGTKPI YJKEJ KPETGCUGU G[GUVTCKP
and creates the feeling that rotating objects are moving less
than they really are.
Ausencia de efecto estroboscópico
Consecuencia de utilizar corriente alterna en las redes de
alimentación, la intensidad de la lámpara pasa por cero dos
veces por periodo, disminuyendo su intensidad luminosa
casi a cero en esos momentos. Esto ocasiona un parpadeo
que aumenta la fatiga visual y produce una sensación de un
movimiento menor al real en los cuerpos en rotación.
With the use of electronic ballasts the lamp is powered by
high frequency, this means that the instants in which the intensity passes zero are so short that they are imperceptible
to the human eye, in this way an annoying and harmful phenomenon is corrected.
Usando balastos electrónicos la lámpara se alimenta en
alta frecuencia, por lo que los instantes de paso por cero de
la intensidad son de un valor temporal tan pequeño que son
imperceptibles para el ojo humano, corrigiéndose así este
molesto y peligroso fenómeno.
0QƀKEMGTKPIFWTKPIUVCTV
The use of electronic ballasts eliminates the characteristic
ƀKEMGTKPI FWTKPI VJG KIPKVKQP QH ƀWQTGUEGPV NCORU YKVJ EQPventional equipment; this provides a more agreeable ignition.
Sin parpadeos en arranque
El uso de balastos electrónicos elimina el parpadeo caTCEVGTÈUVKEQ GP GN GPEGPFKFQ FG NCU N¶ORCTCU ƀWQTGUEGPVGU
con equipo convencional, proporcionando un encendido más
agradable.
0QƀKEMGTKPIYKVJDWTPVQWVNCOR
9JGPƀWQTGUEGPVNCORUYJKEJHWPEVKQPYKVJEQPXGPVKQPCN
equipment reach the end of their lives and are burnt out, they
RTQFWEGCPCPPQ[KPIƀKEMGTKPICUVJGUVCTVGTEQPVKPWCNN[VTKGU
to start them.
Ausencia de parpadeos con lámpara agotada
.CU N¶ORCTCU ƀWQTGUEGPVGU HWPEKQPCPFQ EQP GSWKRQ
EQPXGPEKQPCN CN ſPCN FG UW XKFC EWCPFQ GUV¶P CIQVCFCU
producen un molesto parpadeo al intentar ser encendidas
continuamente por el cebador.
ELT’s electronic ballasts have devices which automatically
disconnect the lamp when they detect that it is faulty or burnt
out.
Los balastos electrónicos de ELT disponen de los dispositivos oportunos que desconectan la lámpara automáticamente cuando la detectan agotada o averiada.
5VCDKNK\CVKQPQHRQYGTCPFNWOKPQWUƀWZ
ELT’s electronic ballasts provide complete power stability
KPVJGNCORCPFCUCTGUWNVKPVJGNWOKPQWUƀWZKPVJGHCEGQH
XCTKCVKQPUKPVJGUWRRN[XQNVCIGWRVQvQHVJGPQOKPCN
voltage in the ballast, providing a constant level of lighting.
'UVCDKNK\CEKÎPFGRQVGPEKC[ƀWLQNWOKPQUQ
Los balastos electrónicos de ELT proporcionan una completa estabilidad de la potencia en lámpara y por tanto del
ƀWLQ NWOKPQUQ CPVG XCTKCEKQPGU FG NC VGPUKÎP FG CNKOGPVCción, de hasta el ±10% de la tensión nominal de la reactancia, proporcionando un nivel de iluminación constante.
.QYGTFGRTGEKCVKQPQHVJGNWOKPQWUƀWZ
&WG VQ VJG JKIJGT RQYGT CPF NWOKPQWU ƀWZ UVCDKNK\CVKQP
that the high frequency ballasts provide, a higher uniformity in the electrical parameters is obtained and as a result a
NQYGTFGVGTKQTCVKQPKPVJGNCORŏUƀWZCUVKOGRCUUGU
/GPQTFGRTGEKCEKÎPFGNƀWLQNWOKPQUQ
&GDKFQCNCOC[QTGUVCDKNK\CEKÎPFGRQVGPEKC[ƀWLQNWOKnoso que proporcionan los balastos de alta frecuencia, se
obtiene una mayor uniformidad en los parámetros eléctricos,
[EQOQEQPUGEWGPEKCWPOGPQTFGVGTKQTQGPGNƀWLQFGNC
lámpara con el paso del tiempo.
%
100
90
Flujo luminoso
Luminous flux
Silent Operation
Using electronic ballasts in
luminaires eliminates the buzzing that in some situations can
be caused with conventional
equipment due to the magnetic
ſGNFNGCMCIG
80
70
60
50
100
2.500
5.000
7.500
10.000
12.500
T (h)
Funcionamiento a 50 Hz / Operating at 50 Hz
Funcionamiento en Alta Frecuencia (HF) / HF operating
Funcionamiento silencioso
Utilizando balastos electrónicos en las luminarias se
consigue eliminar el zumbido
que se puede producir en algunas situaciones con equipos
convencionales debido al campo magnético disperso.
4GURGEVKPIVJG'PXKTQPOGPV
Respeto del entorno
$GVVGTGPGTI[GHſEKGPE[
$GVVGTGPGTI[GHſEKGPE[KUQDVCKPGFYKVJGNGEVTQPKEDCNNCUVU
in comparison with electromagnetic ballasts due to better
NWOKPQWUQWVRWVCPFNQYGTNQUUGU6JGGPGTI[GHſEKGPE[KPdexes EEI=A1, A2 or A3 are reached.
· /C[QTGſEKGPEKCGPGTIÃVKEC
Con los balastos electrónicos, por poseer un mayor rendimiento luminoso y menores pérdidas, se obtienen una mejor
GſEKGPEKC GPGTIÃVKEC SWG EQP TGCEVCPEKCU GNGEVTQOCIPÃVKECU CNECP\CPFQ ÈPFKEGU FG GſEKGPEKC GPGTIÃVKEC ''+#
#Q#UGIÕPNCENCUKſECEKÎPFGNCFKTGEVKXCFGGſEKGPEKC
energética.
www.elt.es
153
Low heating
Thanks to the previously mentioned advantages, that is
to say, lower total power, smaller temperature increases are
obtained.
Bajos calentamientos
Gracias a las ventajas comentadas, menor potencia total,
se obtienen incrementos de temperatura menores.
Decrease in waste
The longer life of the lamps causes a notable reduction in
the disposal of burnt out lamps.
Disminución de residuos
La mayor duración de las lámparas proporciona una notable disminución de lámparas agotadas residuales.
Electromagnetic compatibility EMC
ELT’s electronic ballasts satisfy the requirements established by the electromagnetic compatibility Directive
2004/108/CE by being immune and not causing interference
with other equipment near them.
Compatibilidad electromagnética EMC
Las balastos electrónicos de ELT satisfacen los requisitos
establecidos por la directiva de compatibilidad electromagnética 2004/108/CE, siendo inmunes y no causando interferencias a otros equipos de su entorno.
Mains supply harmonics
Thanks to the design of ELT’s electronic ballasts, the level
of harmonics is well below the limits established in the EN
61000-3-2 standard.
Armónicos de la red de alimentación
Gracias al diseño de los balastos electrónicos de ELT, el
nivel de armónicos queda muy por debajo de los límites establecidos en la norma EN 61000-3-2.
Radio electrical Interferences
The operation of lamps with high frequency can interfere
with other equipment. ELT’s ballasts operate within the limits
established in the EN 55015 standard.
Interferencias radioeléctricas
El funcionamiento de las lámparas en alta frecuencia puede provocar interferencias a otros equipos. Las reactancias
de ELT cumplen con los límites establecidos por la norma
EN 55015.
2QUUKDKNKV[QHFKOOKPIVJGNWOKPQWUƀWZ
2QUKDKNKFCFFGTGIWNCEKÎPFGNƀWLQNWOKPQUQ
6JGGNGEVTQPKEDCNNCUVUCNNQYVJGNWOKPQWUƀWZQHVJGƀWQrescent lamps to be dimmed from 1 to 100% with the consequent reduction in consumption and obtaining a level of
lighting adequate to the necessities of each installation and
at each given moment.
#NIWPQUDCNCUVQUGNGEVTÎPKEQURGTOKVGPTGIWNCTGNƀWLQNWOKPQUQFGNCUN¶ORCTCUƀWQTGUEGPVGUFGNCNEQPNC
consecuente reducción de consumo y obteniéndose un nivel
de iluminación acorde con las necesidades reales de cada
instalación y en cada momento.
1VJGTKORQTVCPVCFXCPVCIGU
Otras ventajas importantes
~ Un único balasto es válido para diferentes tensiones y
frecuencias de red.
~ Uso de un solo balasto para 1, 2, 3 o 4 lámparas.
~ No necesario cebador de encendido, ni condensador
para alto factor de potencia.
~ Bajo contenido armónico.
~ Pueden funcionar como alumbrado de emergencia alimentadas en corriente continua.
~ Menor peso.
~ Montaje más fácil y rápido.
~ A single ballast could be valid for different mains voltages and frequencies.
~ The use of a single ballast for 1, 2, 3 or 4 lamps.
~ A starter is not necessary, neither is a capacitor for high
power factor.
~ Low harmonic content.
~ Can operate as emergency lighting powered by direct
current.
~ Lighter.
~ Easier and quicker assembly.
1RGTCVKQP$NQEMFKCITCO
Funcionamiento. Diagrama de bloques
The basic general structure of an electronic ballast consists of the following blocks or stages:
La estructura general básica de un balasto electrónico
consta de los siguientes bloques o etapas:
~ Filtro de entrada y supresión de interferencias
`'VCRCTGEVKſECFQTC
~ Etapa correctora del factor de potencia
~ Etapa de oscilación y control
~ Etapa de precaldeo
~ Etapa de salida
`+PRWVſNVGTCPFKPVGTHGTGPEGGNKOKPCVKQP
~ Rectifying stage
~ Power factor correcting stage
~ Oscillation and control stage
~ Preheating stage
~ Output stage
R
E
D
/
M
A
I
N
S
Filtros y etapas
supresoras
de interferencias
Conversión
AC / DC
Rectificación
Corrector
del factor
de potencia
Etapa
de oscilación
y control
Etapas de
precaldeo
y salida
Interference filters
and elimination
stages
AC / DC
Conversion and
Rectification
Power factor
correcting stage
Oscillation
and control
stage
Preheating
and output
stage
154
L
A
M
P
A
R
A
S
/
L
A
M
P
S
www.elt.es
(KNVGTCPFKPVGTHGTGPEGGNKOKPCVKQP
Filtro y supresión de interferencias
Electronic ballasts are devices which operate with high
voltage commutation and high frequency. They are important
sources of electrical noise and undesirable emissions which
must be eliminated or reduced according to the requirements
of the standards.
Los balastos electrónicos son aparatos que operan en
altas tensiones de conmutación y altas frecuencias, siendo
fuentes importantes de ruidos eléctricos y emisiones no deseables, que deben ser eliminados o disminuidos según exigencias de la normativa.
This stage is formed by a circuit of coils and capacitors
which shunt unwanted components to the earth wire in the
form of dispersed or leakage currents. It carries out the following functions:
Esta etapa está formada por un circuito de bobinas y condensadores, que derivan a tierra las componentes no deseadas en forma de corrientes de dispersión o de fuga. Realiza
las siguientes funciones:
~ The reduction of emissions conducted from high frequency to the mains in accordance with the limits established in the applicable standard (EN 55015).
~ The reduction of harmonics to below the limits established marked by the standard (EN 61000-3-2).
~ It contributes to the improvement in the power factor, due
to the fact it reduces the high frequency modulation in
the mains current wave.
~ Disminuir las emisiones conducidas de alta frecuencia a
la red de acuerdo a los límites establecidos por la normativa aplicable (EN 55015).
~ Disminuir los armónicos por debajo de los límites marcados por la normativa (EN 61000-3-2).
~ Contribuye a la mejora del factor de potencia, ya que
reduce la modulación de alta frecuencia en la onda de
corriente de alimentación.
4GEVKH[KPIUVCIG
'VCRCTGEVKſECFQTC
The main aim of the rectifying stage is to convert the input
alternating voltage to pushed direct voltage.
.CGVCRCTGEVKſECFQTCVKGPGRQTſPCNKFCFEQPXGTVKTNCVGPsión alterna de entrada en una tensión continua pulsada.
2QYGTHCEVQTEQTTGEVKPIUVCIG
Etapa correctora del factor de potencia
6JGRQYGTHCEVQTKUFGſPGFCU
'NHCEVQTFGRQVGPEKCUGFGſPGEQOQ
~ The phase displacement indicator between the voltage
and current in an electrical circuit
~ The indicator of the deformation of the current into the
shape of a wave with respect to the voltage.
~ Indicador del desfase entre la tensión y corriente de un
circuito eléctrico
~ Indicador de la deformación de la forma de onda de corriente respecto de la tensión
The main aim of the power factor correcting stage is to
make the value of the power factor as close to 1 as possible.
.CGVCRCEQTTGEVQTCFGNHCEVQTFGRQVGPEKCVKGPGRQTſPCNKdad acercar el valor de éste lo más posible a 1.
Additionally a high voltage electrolytic capacitor is conPGEVGFCVVJGQWVNGVQHVJGTGEVKſGTQTVJGRQYGTHCEVQTEQTTGEVKPIUVCIGVQƀCVVGPVJGFKTGEVXQNVCIGKORWNUGU
Además de colocar un condensador electrolítico de alta
VGPUKÎPCNCUCNKFCFGNTGEVKſECFQTQFGNCGVCRCFGEQTTGEción del factor de potencia para aplanar las pulsaciones
de la tensión continua.
1UEKNNCVKQPCPFEQPVTQNUVCIG
Etapa de oscilación y control
The oscillation and control stage has the following aims:
.CGVCRCFGQUEKNCEKÎP[EQPVTQNVKGPGNQUUKIWKGPVGUſPGU
~ To transform the DC Direct current into HF-AC High frequency altern current.
~ To control the heating, start, rearming, etc times
~ To control and excite the output stage
~ To control possible abnormal situations such as burnt out
lamps, over voltage, short circuits, etc.
~ ELT has developed a system with state-of-the-art technology for Electronic Ballasts. This system is based on
VJG WUG QH OKETQRTQEGUUQTU YJKEJ IKXG OCZKOWO ƀGZibility and reliability to the equipment
~ Transformar la corriente continua en alterna de alta frecuencia.
~ Controlar los tiempos de precaldeo, ignición, rearme,
etc.
~ Controlar y excitar la etapa de salida
~ Controlar las posibles situaciones anormales tales como
lámpara fundida, sobretensiones, cortocircuitos, etc.
~ ELT ha desarrollado un sistema con las últimas tecnologías disponibles para Balastos Electrónicos, basado en
GN WUQ FG OKETQRTQEGUCFQTGU SWG EQPſGTGP GN O¶ZKOQ
FGƀGZKDKNKFCF[ſCDKNKFCFCNQUGSWKRQU
2TGJGCVKPIUVCIG
Etapa de precaldeo
This heats the electrodes before start, so favouring it and
increasing the durability of the electrodes and as a result, of
the lamp.
Realiza un calentamiento de los electrodos previo al encendido, favoreciéndolo y aumentando la durabilidad de los
electrodos y por tanto de la lámpara.
Pre-heating is especially important in those devices which
are switched on a large number of times per day.
El precaldeo es especialmente importante en aquellas
aplicaciones que requieren un alto número de encendidos
diarios.
Output stage
Etapa de salida
It is the responsibility of this stage to generate the square
voltage wave and the high frequency which, through a ferrite
ballast, will be applied to the lamp/s.
Esta etapa es la encargada de generar la onda cuadrada
de tensión y alta frecuencia que, a través de una bobina con
núcleo de ferrita, se aplicará a la/s lámpara/s.
www.elt.es
155
6[RGUQHGNGEVTQPKEDCNNCUVU
Tipos de balastos electrónicos
'NGEVTQPKEDCNNCUVUCEEQTFKPIVQVJGUVCTVU[UVGO
Balastos electrónicos según el sistema de encendido
A ballast’s start time is considered the time that goes by
from the moment in which the voltage is supplied to the system until the light shines.
Se considera tiempo de encendido de un balasto, al periodo de tiempo transcurrido desde que se le suministra tensión
al sistema hasta que luce la lámpara.
Due to this period of time and the ignition method used, the
GSWKROGPVECPDGENCUUKſGFVJQUGQHKPUVCPVCPGQWUUVCTVQT
cold start and those with cathode preheating or warm start.
En función de este periodo de tiempo y el método de enEGPFKFQWVKNK\CFQUGRWGFGPENCUKſECTNQUGSWKRQUFGGPEGPdido instantáneo o de arranque en frío, y con precalentamiento de cátodos o de arranque en caliente.
Instant start
When the lamp starts without preheating the cathodes that
is to say with the lamps cathodes cold, it is called instant
start.
Encendido instantáneo
Se denomina encendido instantáneo aquel que se produce en la lámpara sin un precalentamiento previo de los cátodos, es decir, con los cátodos de la lámpara fríos.
This start is generated due to the application of high voltage between the ends of the lamp so that it reaches the start
point or the “Townsend” point.
Este encendido se genera por aplicación de una alta tensión entre los extremos de la lámpara tal que se alcance el
punto de encendido o “punto Towsend”.
Lamps started in this way begin to suffer deterioration in
their cathodes which means that ballasts that use this instant
start system are not suitable for lighting installations which
are switched on more than 2 or 3 times a day.
Las lámparas sometidas a este tipo de encendido sufren
un deterioro incipiente de sus cátodos, por lo que los balastos que utilizan este sistema de encendido instantáneo
sólo son recomendables en instalaciones donde el número
de encendidos sea menor de dos o tres al día.
Start with cathode preheating
This system, also called preheating start or hot switch-on,
consists in heating the lamp’s cathodes by passing an initial
current through them before start.
Encendido con precalentamiento de cátodos
Este sistema, también llamado encendido con precaldeo o
arranque en caliente, consiste en calentar los cátodos de la
lámpara por el paso a través de ellos de una corriente inicial
previa al encendido.
With this the start point or the “Townsend point” is reduced
and gentle start is achieved, however it is not instant but
takes place after a pause of 1 or 2 seconds.
Con ello se reduce el punto de encendido o “punto Towsend” y se origina un encendido suave, no instantáneo, pero
de una corta duración de entre 1 o 2 segundos.
In this way the deterioration in the cathode is not as pronounced as with instant ignition which permits ballasts which
preheat to be used in lighting installations which are switched
on a certain number of times a day.
De este modo el deterioro de los cátodos no es tan acusado como el generado por encendidos instantáneos, lo que
permite a los balastos con precaldeo ser utilizados en instalaciones con cierto número de encendidos al día.
ELT’s ballasts use a preheating start system which extends their life and allows for a greater number of ignitions.
Los balastos electrónicos de ELT poseen encendido con
precalentamiento, alargando la vida y el número de encendidos de las lámparas.
.CORUKPUGTKGUQTKPRCTCNNGN
Lámparas en serie o en paralelo
Models of electronic ballasts for the operation of two or
more lamps exist. The output stage can be designed to make
the lamps operate in series or parallel.
Existen modelos de balastos electrónicos para el funcionamiento de dos o más lámparas. La etapa de salida puede
estar diseñada para hacer funcionar a las lámparas en serie
o en paralelo.
The operation of lamps in parallel means that if one of them
is faulty or burns out, the rest continue to operate correctly
and provide an acceptable level of lighting until the burnt out
lamp can be changed.
El funcionamiento de las lámparas en paralelo permite que
en caso de avería o agotamiento de alguna de las ellas, las
demás continúen funcionando correctamente, manteniendo
un nivel de iluminación aceptable hasta que se sustituya la
lámpara agotada.
$CNNCUVUHQTDWKNVKPWUGQTKPFGRGPFGPVDCNNCUVU
Balastos a incorporar e independientes
Depending on the characteristics of the installation of the
GNGEVTQPKEDCNNCUVUVJGUGECPDGENCUUKſGFCUHQTDWKNVKPWUG
or as independent.
Dependiendo de las características de instalación de los
DCNCUVQUGNGEVTÎPKEQUÃUVQURWGFGPENCUKſECTUGEQOQCKPcorporar o independientes.
Ballasts for built-in use
These are ballasts designed to operate built in the luminaires, boxes or casings that protect them from direct contact
and from the environment.
Balastos a incorporar
Balastos diseñados para funcionar incorporados en luminarias, cajas o envolventes que los protejan de los contactos
directos y del medio ambiente.
Independent ballasts
These are ballasts which can be separately assembled
in the exterior of a luminaire without an additional casing.
These are manufactured with different degrees of protection.
Balastos independientes
Balastos que pueden montarse separadamente en el exterior de una luminaria y sin envolvente adicional. Se fabrican
con diversos grados de protección.
156
www.elt.es
In order to use electronic ballasts in exterior lighting installations or illuminated signs without any additional protection,
the degree of protection that its own casing provides must be
ſTUVHQWPFVQDGUWHſEKGPV
Para poder usar balastos electrónicos en instalaciones o
rótulos a la intemperie, sin ninguna protección adicional, se
debe asegurar que el grado de protección de su envolvente
sea el adecuado.
ELT offers electronic ballasts with a high degree of IP-67
protection for harsh exterior conditions.
ELT ofrece balastos electrónicos de alto grado de protección IP-67 para duras condiciones ambientales.
$CNNCUVUFGRGPFKPIQPVJGV[RGQHNCOR
Balastos en función del tipo de lámpara
Los principales tipos de balastos electrónicos de ELT son
los expuestos a continuación:
The following are ELT’s principal ballasts:
~ Ballasts for T8 linear lamps and TC-L compact lamps.
~ Ballasts for TC-S, TC-DE, TC-TE compact lamps.
~ Ballasts for T5 / HE linear lamps.
~ Ballasts for T5 / HO linear lamps.
~ Balastos para lámparas lineales T8 y compactas largas
TC-L.
~ Balastos para lámparas compactas TC-S, TC-DE,
TC-TE .
~ Balastos para lámparas lineales T5 / HE.
~ Balastos para lámparas lineales T5 / HO.
&%'NGEVTQPKEDCNNCUVU
Balastos electrónicos alimentados
en corriente continua
Electronic ballasts powered by direct current (DC) are
WUGFKPXGT[URGEKſEKPUVCNNCVKQPUUWEJCU
Los balastos electrónicos con alimentación en corriente
EQPVKPWCUQPWVKNK\CFQUGPCRNKECEKQPGUOW[GURGEÈſECUGPtre las que se encuentran:
~ Emergency lighting powered by batteries in case of a
fault in the mains
~ Public transport vehicles such as trains, ships, trams,
buses etc.
~ Objects for domestic use such as camping lights
ELT has incorporated CE1 type electronic ballasts for
these installations in its catalogue.
~ Iluminación de emergencia siendo alimentados por baterías en caso de fallo de la red.
~ Vehículos de transporte públicos como trenes, barcos,
tranvías, autobuses, etc.
~ Objetos de uso domésticos como iluminación para camping.
ELT incorpora en su catálogo balastos electrónicos tipo
CE1 para dichas aplicaciones.
'NGEVTQPKEDCNNCUVUTGNKCDKNKV[
Vida de los balastos electrónicos
6JGITGCVTGNKCDKNKV[CPFVQVCNHWNſNOGPVQHUGEWTKV[TGIWNCtions, features and elimination of interference make ELT’s
ballasts the most recommendable alternative for interior lightKPI KP QHſEGU RWDNKE RTGOKUGU KPFWUVTKGU GFWECVKQPCN EGPtres, hospitals, etc
.C ITCP ſCDKNKFCF [ WPC VQVCN TGURWGUVC C NCU PQTOCVKXCU
de seguridad, prestaciones y supresión de interferencias
presentan a los balastos de ELT como la alternativa más reEQOGPFCDNGGPKNWOKPCEKQPGUKPVGTKQTGUFGQſEKPCUNQECNGU
públicos, industrias, centros de enseñanza, hospitales, etc.
ELT has a catalogue with a wide range of high quality electronic ballasts manufactured with state of the art technology,
based on the use of microprocessors which ensure a high
degree of self-protection, switching themselves off in the face
of the following external anomalies:
~ Micro power cuts.
~ Mains transients out with regulations.
~ Mains voltage out with normal range.
~ Errors in the lamps connections.
~ Burnt out lamps.
~ Short-circuit cathodes.
~ Incorrect lamps.
ELT ofrece un amplio catálogo de balastos electrónicos de
primera calidad fabricados con la tecnología más vanguardista, basada en el uso de microprocesadores que asegura
un alto grado de autoprotección, desactivándose frente a
anomalías externas tales como:
~ Micro cortes de red.
~ Transitorios de red fuera de normas.
~ Tensión de red fuera de rango.
~ Errores de conexión de lámpara.
~ Lámparas agotadas.
~ Cátodos en cortocircuito.
~ Lámparas incorrectas.
'NGEVTQPKEDCNNCUVCXGTCIGUGTXKEGNKHG
Vida media de los balastos electrónicos
Electronic ballasts being less robust than the conventional
electromagnetic ones must be treated carefully , as if they
YGTG JKſ EQORQPGPVU XKFGQ VCRG TGEQTFGTU QT CP[ QVJGT
electronic devices.
Los balastos electrónicos, por ser menos robustos que las
reactancias convencionales, deben ser tratados con cuidado, como si de un equipo de música, un reproductor de DVD
o cualquier otro equipo electrónico se tratase.
The average service life of the electronic ballasts relays
on the working temperature and the electronic components’
quality employed.
As with all electronic devices, the high frequency ballasts
consumes energy in order to operate; this energy is all turned
into heat.
La vida media de los balastos electrónicos depende de la
temperatura de trabajo y de la calidad de los componentes
utilizados.
www.elt.es
Como todo elemento electrónico, el balasto de alta frecuencia tiene un consumo propio para su funcionamiento,
que se transforma íntegramente en calor.
157
To avoid overheating, a temperature control (tc) point on
the ballasts casing gives a reference point to a measure the
temperature to check that it does not exceed a value speciſGFD[VJGOCPWHCEVWTGT
Para controlar el calentamiento, los balastos electrónicos
llevan indicado sobre la envolvente un punto donde debe medirse la temperatura para comprobar que no se sobrepasa el
valor indicado por el fabricante. Este punto se denomina tc.
tc (ºC)
Vida media de reactancias electrónicas / Electronic ballasts average service file
100
90
80
70
60
50
40
30
20
10
0
Horas de vida de los balastos electrónicos
en función de la temperatura tc
Electronic ballasts average service life
in relation to the Tc temperature
10
20
30
40
50
60
70
80
90
100
110
120
130
140
Horas de vida (x1.000) (h) / Lifetime (x1.000) (h)
Operating at the maximum temperature indicated in the
temperature control point tc, a service life of 50.000 hours
could be anticipated. A reduction of temperature could increase the average service life. But an increase of it on the
ballasts tc would shorten considerably the average service
life.
Funcionando a la temperatura máxima indicada en el
punto tc cabe esperar una vida media de 50.000 horas. Una
temperatura inferior a la marcada alargará la vida media estimada, pero una temperatura superior la podría acortar de
HQTOCUKIPKſECVKXC
The manufacturing of ELT electronic ballasts is made with
ſTUV SWCNKV[ GNGEVTQPKE EQORQPGPVU # UVTKPIGPV RTQEGUU QH
VGUVKPITCYEQORQPGPVſPKUJGFRTQFWEVCPFNKHGVKOGVGUVKU
carried out. Thus guaranteeing the average service life expected and full reliability and operating security.
Además, la fabricación de los balastos electrónicos de
ELT con componentes electrónicos de primera calidad, junto
con los ensayos y pruebas de vida realizados, garantizan
NCXKFCOGFKCGURGTCFC[WPCVQVCNſCDKNKFCF[UGIWTKFCFFG
funcionamiento
.
)WKFGUHQTVJGFGUKPIQHJKIJHTGSWGPE[
NWOKPCKTGU
Guías para el diseño de luminarias en
alta frecuencia
As well as respecting the previous installation recommendations, special attention must also be paid to the design of
the luminaires with electronic ballasts in order to guarantee
good electromagnetic compatibility.
Además de respetar las recomendaciones de instalación
anteriores, debe prestarse especial atención al diseño de
las luminarias con balastos electrónicos para garantizar una
buena compatibilidad electromagnética.
'NGEVTQOCIPGVKEEQORCVKDKNKV[
Compatibilidad electromagnética
'NGEVTQOCIPGVKEEQORCVKDKNKV[KUFGſPGFCUVJGECRCEKV[QH
an apparatus, device or system to function in electromagnetic surroundings, without producing interference that is unacceptable for its surroundings.
5GFGſPGEQORCVKDKNKFCFGNGEVTQOCIPÃVKECEQOQNCECRCcidad de un aparato, dispositivo o sistema para funcionar
satisfactoriamente en un entorno electromagnético, sin producir interferencias inaceptables para su entorno.
The term electromagnetic compatibility covers two aspects. On one hand the insurance of a low level of emissions
or interferences for the surroundings, and on the other the
insurance of its own immunity to emissions and interferences
in the surroundings.
El término compatibilidad electromagnética engloba dos
aspectos. Por un lado asegurar un nivel bajo de emisiones
o interferencias al entorno, y por otro, asegurar su propia inmunidad frente a las emisiones o interferencias del entorno.
Para asegurar la buena compatibilidad electromagnética
de un sistema eléctrico o electrónico, existen normas que
establecen límites a las interferencias emitidas.
To ensure good electromagnetic compatibility in an electrical or electronic system, regulations which establish the limits of interferences emitted exist.
Las principales normas relacionadas de aplicación para
los equipos de iluminación son:
The main standards related with lighting equipment that
must be applied are:
EN 61000-3-2 (former EN 60555-2)
Electromagnetic compatibility (EMC).
Part 3: Limits.
Section 2: Limits for harmonic current
emissions (equipment with input current
less than or equal to 16 A per phase).
EN 61457
EN 55015
EN 61000-3-2
General use lighting equipment.
Immunity requirements - EMC.
Limits and methods to measure the characteristics relative to the radio electrical
disturbance in lighting or similar equipment (conducted and radiated interferences < 30 MHz).
EN 61457
EN 55015
158
(antigua EN 60555-2)
Compatibilidad electromagnética (CEM).
Parte 3: Límites.
Sección 2: Límites para las emisiones
de corriente armónica (equipos con corriente de entrada menor o igual que 16
A por fase).
Equipos para alumbrado de uso general.
Requisitos de inmunidad - CEM.
Límites y métodos de medida de las características relativas a la perturbación
radioeléctrica de los equipos de iluminación y similares (interferencias conducidas y radiadas < 30 MHz).
www.elt.es
6[RGUQHKPVGTHGTGPEGU
Tipos de interferencias
The interferences can be divided into two types:
Las interferencias pueden dividirse en dos tipos:
~ Conducted interference: conducted through the mains
wires.
~ Radiated interference: emitted into the surroundings.
~ La interferencia conducida: conducida a través de los
cables a la red
~ Interferencia radiada: la emitida al entorno
They can then be subdivided into:
Pueden subdividirse nuevamente en:
~ Conducted interference:
~ Harmonic distortion in the mains.
~ Conducted interference (RFI).
~ Radiated interference:
`/CIPGVKEſGNF
4(+
`'NGEVTKECNſGNF
4(+
~ Interferencia conducida:
~ Distorsión armónica de la red
~ Interferencia conducida (RFI)
~ Interferencia radiada:
~ Campo magnético (RFI)
~ Campo eléctrico (RFI)
6JQUG GNGEVTQOCIPGVKE ſGNFU YJKEJ ECP FKUVWTD VJG TCFKQ
and television are known as Radio frequency Interferences
(R.F.I.).
Se denominan Interferencias de Radio Frecuencia (R.F.I.)
a los campos electromagnéticos que pueden perturbar la radio y la televisión.
+PVGTHGTGPEGYKVJGNGEVTQPKEDCNNCUVUNCORU
CPFNWOKPCKTGU
Interferencias con balastos electrónicos, lámparas y
luminarias
Conducted interferences
~ The harmonic distortion and a part of the conducted distortions are generated by the ballasts own internal operation and in order to correct this, the manufacturer must
CRRN[VJGEQTTGURQPFKPIſNVGTUYJKEJUVQRVJGFKUVQTVKQPU
from getting into the mains.
~ Other conducted interferences are produced by the interference capacities which exist between:
~ The cables of the lamp and those of the mains (C1)
~ The cables of the lamps and the luminaire (C2)
~ The lamp and the luminaire (C3)
~ The lamp and earth (C4)
· Interferencias conducidas
~ La distorsión armónica y una parte de las conducidas
son generadas por el propio funcionamiento interno del
balasto, y para corregirlo el fabricante debe aplicar los
ſNVTQUEQTTGURQPFKGPVGURCTCGXKVCTSWGUCNICPCNCTGF
~ Otras interferencias conducidas son producidas por las
capacidades parásitas que existen entre:
~ Los cables de lámpara y los de red (C1)
~ Los cables de lámpara y la luminaria (C2)
~ La lámpara y la luminaria (C3)
~ La lámpara y tierra (C4)
PANTALLA / LUMINAIRE
N
L
The currents that these capacities cause will escape into
the mains and introduce interferences there if actions to
avoid this are not taken.
Las corrientes que originan estas capacidades saldrán a la
red si no se toman acciones que lo eviten, con la consiguiente introducción de interferencias en red.
Some of these are corrected by the ballast’s internal make
up, but others must be minimized by taking care with the luminaire’s structure, its installation and wiring.
Parte de ellas son corregidas por la construcción interna
del balasto, pero otras deben minimizarse cuidando la forma
constructiva de la luminaria, su instalación y el cableado.
The input wiring within the luminaire must be as short as
possible, directly connected and located as far away as possible from the other lamp cables and from the lamps themselves in order to reduce the interference capacities to a
minimum.
El cableado de alimentación dentro de la luminaria debe
ser lo más corto posible, conectado directamente y alejado
al máximo de los otros cables de lámparas y de las propias
lámparas para minimizar las capacidades parásitas.
A good electrical connection between the luminaire, the
TGƀGEVQTCPFVJGDCNNCUVCPFDGVYGGPGCEJQHVJGOCPFVJG
earth wire will greatly favour their elimination.
Radiated interferences
`4CFKCVGFKPVGTHGTGPEGUOCIPGVKEſGNF
*
This is principally produced by the lamp and its wiring
and the ballast. It depends on area A which surrounds
the lamp’s current.
www.elt.es
7PCDWGPCEQPGZKÎPGNÃEVTKECGPVTGNCNWOKPCTKCGNTGƀGEtor y el balasto, y de ambos al conductor de tierra, favorecerá
de gran manera su eliminación.
· Interferencias radiadas
~ Interferencia radiada - campo magnético (H)
Es producida principalmente por la lámpara y su cableado con el balasto. Depende del área A que rodea la
corriente de lámpara.
159
6JG OCIPGVKE ſGNFU ECP DG MGRV NQY D[ TGFWEKPI CTGC #
as much as possible, or by using additional screening which
forms a part of the luminaire. In this way, currents will be also
prevented entering the input cable so reducing conducted interference.
'NECORQOCIPÃVKEQRWGFGOCPVGPGTUGDCLQFKUOKPW[GPdo al máximo el área A, o usando un apantallamiento adiEKQPCNSWGHQTOGRCTVGFGNCNWOKPCTKC#UÈVCODKÃPRTGXKGPG
que se introduzcan corrientes en el cable de alimentación,
que incrementará las interferencias conducidas.
L
N
`+PVGTHGTGPEKCTCFKCFCECORQGNÃEVTKEQ
'
Debido a los armónicos de la tensión de la lámpara,
ÃUVCTCFKCWPECORQGNÃEVTKEQ
`4CFKCVGFKPVGTHGTGPEGŌGNGEVTKECNſGNF
'
Due to the lamp’s voltage harmonics, it radiates an
GNGEVTKECNſGNF
The harmonics are considerably reduced by an additional
ſNVGT KP VJG DCNNCUV VJG KPVGTHGTence radiated into the surroundings can be reduced with screening, and the interference capacities between the cables and the
luminaire can be reduced using
separators on the luminaire’s
surfaces.
Los armónicos se reducen considerablemente mediante
WP ſNVTQ CFKEKQPCN GP GN DCNCUVQ
la interferencia radiada a los alrededores puede reducirse mediante apantallamientos, y se minimizan las capacidades parásitas entre los cables y la luminaria
utilizando separadores respecto
CNCUUWRGTſEKGUFGNCNWOKPCTKC
Screening effect
6JGOCIPGVKEſGNF
*TCFKCVGF
by lamps is reduced by the currents induced by screening. Due
to this, it is necessary to construct
the luminaires with a metallic material, which is a good conductor
and obviously well connected to
the earth circuit.
· Efecto apantallamiento
'NECORQOCIPÃVKEQ
*TCFKCdo por las lámparas se reduce
por las corrientes inducidas en el
apantallamiento. Por lo tanto, es
necesario construir las luminarias
con un material metálico, buen
conductor y evidentemente bien
conectado al circuito de tierra.
6JG ſIWTG DGNQY UJQYU VJG
TGFWEVKQPKPVJGOCIPGVKEſGNFKP
the luminaire with screening.
'P NC ſIWTC UG OWGUVTC NC TGFWEEKÎPFGNECORQOCIPÃVKEQGP
la luminaria con apantallamiento.
6JGGNGEVTKECNſGNF
'CNYC[U
perpendicularly directed at the
metallic surfaces, is reduced by
a capacitive screening, in such a
way that the currents can return to the circuit resulting in low
surrounding currents.
'N ECORQ GNÃEVTKEQ ' UKGOpre dirigido perpendicularmente
C NCU UWRGTſEKGU OGV¶NKECU UG
reduce por un apantallamiento
capacitivo, de tal manera que las corrientes pueden retornar
al circuito resultando corrientes circundantes bajas.
The screen must be a good conductor and have low contact resistance with the high frequency ballast, for this reason
the use of separators in the assembly of the ballast in the
luminaire must be avoided.
El apantallamiento debe ser buen conductor y tener una
baja resistencia de contacto con el balasto de alta frecuencia, por lo que no se recomienda el uso de separadores en el
montaje de la reactancia en la luminaria.
In the case of installations without screening, it is recommended to take the appropriate measures.
Ante instalaciones sin pantallas, se recomienda tomar las
medidas oportunas.
$CUKETWNGUHQTNWOKPCKTGFGUKIP
Reglas básicas de diseño de luminarias
6JG HWNſNOGPV QH GNGEVTQOCIPGVKE EQORCVKDKNKV[ DCUKECNN[
concerns the device made up of ballasts, lamps, luminaires
and wiring.
'N EWORNKOKGPVQ FG NC EQORCVKDKNKFCF GNGEVTQOCIPÃVKEC
concierne básicamente, al conjunto formado por balastos,
lámparas, luminaria y cableado.
The indications mentioned in the previous points must be
respected together with those mentioned in section 5, “Installation recommendations”, to optimize the system’s electromagnetic compatibility. Examples where said recommendations are illustrated follow.
Deben respetarse las indicaciones de los puntos anteriores junto con las del apartado “Recomendaciones
de instalación”, para optimizar la compatibilidad elecVTQOCIPÃVKEC FGN UKUVGOC # EQPVKPWCEKÎP UG GZRQPGP
ejemplos donde se ilustran dichas recomendaciones.
160
www.elt.es
Grids
6JG ſIWTG DGNQY TGRTGUGPVU C
basic grid. The assembly board
JCU DGGP WUGF CU C TGƀGEVQT CPF
as a screen and has good electrical contact with the high frequency
ballast. The wires are short and
due to this the interference capacities between the lamp and itself
and the wires and themselves and
between both of them are low.
Regletas
'P NC ſIWTC UG TGRTGUGPVC WPC
regleta básica. La placa de monVCLGJCUKFQWUCFCEQOQTGƀGEVQT
y como apantallamiento y tiene
buen contacto eléctrico con el balasto de alta frecuencia. Los hilos
son cortos y por ello las capacidades parásitas entre la lámpara
y los hilos y de estos entre sí, es
baja.
6JG HQNNQYKPI ſIWTG UJQYU C YGNN FGUKIPGF CPF C DCFN[
FGUKIPGFITKFYKVJTGƀGEVQT
'PNCſIWTCUKIWKGPVGUGOWGUVTCWPDWGP[WPOCNFKUGÌQ
FGWPCTGINGVCEQPTGƀGEVQT
In the second image a badly designed grid can be observed. The fault is due to the fact that the mains wires are
close to or crossed with those of the lamp, this causes the
appearance of interference capacities with their consequent
problems. If the wires of the lamp which cross with input
wires are “hot wires” the problems will be more serious.
En la segunda imagen se observa un mal diseño por estar
próximos o entrecruzados los cables de red con los de la
lámpara, apareciendo capacidades parásitas con los consecuentes problemas, de mayor importancia si los hilos de la
lámpara cruzados con los de la alimentación, son los “hilos
calientes”.
Luminaires
6JGHQNNQYKPIſIWTGUUJQYUCPGZCORNGQHCYGNNFGUKIPGF
luminaire, with a short input wire which immediately exits
the luminaire. The luminaire acts as a screen, reducing the
GNGEVTQOCIPGVKEſGNFU
Luminarias
.CUKIWKGPVGſIWTCOWGUVTCWPGLGORNQFGWPDWGPFKUGÌQ
de una luminaria, con el cable de alimentación corto y saliendo inmediatamente al exterior. La luminaria actúa como
apantallamiento, reduciendo los campos electromagnéticos.
It is not recommended to install separators between the
DCNNCUVCPFVJGNWOKPCKTGDGECWUGKVKUFKHſEWNVCPFECPGNKOKnate the electrical contact between them.
No es recomendable colocar separadores entre el balasto
[NCNWOKPCTKC[CSWGUGFKſEWNVCGKPENWUQGNKOKPCGNEQPVCEVQ
eléctrico entre ambos.
In a luminaire with two lamps it is advisable that assembly
of the ballast is carried out between the two lamps, instead
of assembling it on one side. The lamp’s long cables must be
kept close to the lamp in a way that they do not form loops.
En una luminaria de dos lámparas es aconsejable que el
montaje del balasto se realice entre las dos lámparas, en
lugar de montarla a un lado. Los cables largos de lámpara
se mantienen próximos al mismo y de forma que no hagan
bucles.
The assembly with the ballast at one side of the lamps is
not recommended.
www.elt.es
No se recomienda el montaje con el balasto a un lado de
las lámparas.
161
4GƀGEVQTUCPFFKHHWUGTU
4GƀGEVQTUCPFFKHHWUGTUCTGWUGFKPVJGOCLQTKV[QHNWOKnaires. These must be good electrical conductors.
4GƀGEVQTGU[FKHWUQTGU
'PNCOC[QTÈCFGNCUNWOKPCTKCUUGWUCPTGƀGEVQTGUQFKHW
sores. Éstos deben de ser buenos conductores eléctricos.
#TGƀGEVQTCPFCFKHHWUGTCEVKPICUCUETGGPCTGUJQYPKP
VJGHQNNQYKPIſIWTG
'PNCUUKIWKGPVGUſIWTCUUGOWGUVTCWPTGƀGEVQT[WPFKHWsor que actúan como apantallamiento.
They must have good electrical contact with the luminaire
to avoid the appearance of an interference capacity with the
wiring.
Deben hacer buen contacto eléctrico con la luminaria, para
que ésta no presente capacidad parásita con el cableado.
.CHWPEKÎPFGCRCPVCNNCOKGPVQUÎNQUGT¶GſEC\UKNCTGUKUVGPEKC ÎJOKEC GPVTG GN TGƀGEVQT [ NC NWOKPCTKC GU DCLC 7P
buen contacto eléctrico se puede conseguir mediante un hilo
de tierra corto o un muelle de tierra. Los contactos intermitentes pueden hacer que las interferencias sean aún peor
que si no tuviese el apantallamiento.
The screening will only be effective if the ohmic resistance
DGVYGGPVJGTGƀGEVQTCPFVJGNWOKPCKTGKUNQY#IQQFGNGEtrical contact can be achieved through a short earth wire or
an earth spring connector. Intermittent contacts can make
the interferences even worse than if they were not subjected
to screening.
Luminarias con varios balastos en alta frecuencia
'PNCſIWTCUGOWGUVTCGNOQPVCLGO¶UKPVGTGUCPVGFQPFG
el cableado de la alimentación sale lo antes posible fuera
de la luminaria, y los “cables calientes” de lámpara son los
más cortos.
Luminaires with several high frequency ballasts
The most interesting assembly where the input wiring
leaves the luminaire as quickly as possible and the “hot
YKTGUŒCTGVJGUJQTVGUVKUUJQYPKPVJGſIWTGDGNQY
162
www.elt.es
+PUVTWEVKQPUHQTVJGKPUVCNNCVKQPQH
GNGEVTQPKEDCNNCUVUHQTƀWQTGUEGPVNCORU
Instrucciones para la instalación de
balastos electrónicos para lámparas
ƀWQTGUEGPVGU
Electronic ballasts use sensitive electronic components
and should be handled with the same care as a sound system, DVD player or any other electronic equipment. In order
to achieve a long life and correct functioning, both in the ballast and in the lamp, it is necessary to follow some guidelines
in compliance with the manufacturer’s recommendations.
El balasto electrónico utiliza componentes electrónicos
sensibles. Debe ser tratado con cuidado, como si de un
equipo de música, reproductor DVD o cualquier otro equipo
electrónico se tratara. Su instalación requiere seguir unas
pautas acordes con las recomendaciones del fabricante, con
GNſPFGEQPUGIWKTWPCFWTCDKNKFCF[HWPEKQPCOKGPVQCFGEWCdo, tanto del balasto como de la lámpara.
5GEWTKV[
Seguridad
6JGDCNNCUVOWUVDGKPUVCNNGFKPUKFGVJGNKIJVſZVWTG
Maintenance and replacement must be carried out by
SWCNKſGF RGTUQPPGN YKVJ VJG XQNVCIG FKUEQPPGEVGF 6JG
instructions given with the product and the current regulations must be strictly followed.
El balasto debe estar instalado dentro de la luminaria.
Las operaciones de mantenimiento y reposición deben
UGTTGCNK\CFCURQTRGTUQPCNEWCNKſECFQUKPVGPUKÎPFGTGF
y siguiendo rigurosamente las instrucciones dadas sobre
el producto y la reglamentación vigente.
'CTVJYKTG
Conductor de tierra
The use of the earth wire is strictly OBLIGATORY. The
said wire must be connected to the ballasts and the light
ſZVWTG+VKUEQPXGPKGPVVQEQPPGEVVJGOGVCNNKEUVTWEVWTGQH
the false ceiling (if one exists) to the earth wire.
El uso del conductor de tierra es rigurosamente OBLIGATORIO. Debe ser conectado al balasto y a la luminaria. La estructura metálica del falso techo (si existe) es
conveniente conectarla a tierra.
'NGEVTKECNUWRRN[
Alimentación eléctrica
The voltage and frequency of the power line must be
YKVJKPVJGPQTOCNYQTMKPITCPIGURGEKſGFQPVJGDCNNCUV
The polarity indicated must be respected (phase and neutral).
La tensión y frecuencia de alimentación deben estar
dentro del rango normal de funcionamiento. Respetad la
polaridad indicada (fase y neutro).
El funcionamiento en corriente continua, solamente
está permitido para balastos especialmente diseñados al
efecto.
Operation with direct current is only allowed in specially
designed ballasts.
In 400V triphase installations, it must be ensured that
the neutral is always connected, otherwise the 400V could
reach the equipment with the consequent risks. When the
installation is being carried out the load distribution between phases must be balanced as much as possible.
En instalaciones trifásicas a 400V, se debe asegurar
que el neutro esté siempre conectado, si quedara interrumpido, podrían llegar los 400V a los equipos con el
consiguiente riesgo de avería de los balastos. Al realizar
la instalación, debe equilibrar al máximo el reparto de cargas entre fases.
Temperature
Temperatura
The maximum environmental temperature in the installation must be checked in order to ensure it does not exceed the ta marked on the equipment, and an adequate
degree of protection against humidity should be provided.
Se debe comprobar que la máxima temperatura ambiente en la instalación no sobrepasa la ta marcada sobre
el equipo, y asegurar un grado de protección adecuado
contra la humedad.
Without exception, the temperature tc marked on the
case of the ballast should not be exceeded, as continued
use at higher temperatures causes a continued reduction
in the ballast’s life.
En cualquier caso, no se debe superar la temperatura
tc marcada sobre la envolvente del balasto, ya que un
funcionamiento continuado con temperaturas superiores
podría producir una reducción progresiva de la esperanza
de vida del balasto.
$CNNCUVEQPPGEVKQPUCPFEQORQPGPVU
Cableados y componentes de la luminaria
The connection wires between the ballast and the light
ſZVWTGOWUVDGCUUJQTVCURQUUKDNG
PGXGTOQTGVJCP
m), especially in all the wires with higher voltage or ‘hot
wires’ indicated on the ballast.
Los cables de conexión entre balasto y lámpara deben
ser lo más cortos posible (nunca superiores a 2 m), sobre
todo los hilos demayor tensión o “hilos calientes” indicados en el marcaje del balasto.
6GTOKPCNDNQEMCPYKTGRTGRCTCVKQP
Clemas de conexión y preparación del cable
Se recomienda el uso de hilo rígido de un solo conductor de sección 0,5-1,5 mm2. La longitud de pelado
del cable esta indicada en el marcaje de cada una de las
reactancias.
Si se desea extraer un conductor previamente insertado,
no ejercer una fuerza excesiva sobre la leva de desbloqueo de los bornes deconexión para evitar rotura.
The use of only one rigid wire with a section between
0,5 and 1,5 mm2. Data must be checked in the case of all
the ballasts in order to peel the wire off correctly.
If a previously inserted wire is to be extracted, do not
use excessive force on the connection supports to avoid
breaking.
www.elt.es
163
+PUWNCVKQPVGUV
Test de aislamiento
If a insulation test is done on the installation of the circuits which supply power to the electronic ballasts, the
test will be done applying the test voltage between phases and neutrals together and the earth wire. The test voltage will never be apllied between phases and neutral or
between phases.
Si se realiza la prueba de aislamiento a la instalación,
en los circuitos que alimenten balastos electrónicos, el
ensayo se realizará aplicando la tensión de prueba entre fases y neutros todos unidos y el conductor de tierra.
Nunca se aplicará tensión de prueba entre fases y neutro
o entre fases.
(TGSWGPVKIPKVKQP
Encendidos frecuentes
ELT’s preheating electronic ballasts can be used with a
combination of presence sensors, as long as the interval
between ignitions is more than 15 minutes. A high frequency of ignitions can reduce the lamp’s life.
Los balastos electrónicos de ELT con precaldeo pueden ser utilizados incluso en combinación con sensores
de presencia, siempre que el intervalo de encendido sea
mayor de 15 minutos. Una frecuencia alta de encendidos,
puede reducir la vida de la lámpara.
RFI
Radio interferencias
Install connecting cables to the ballast and cables between ballast and lamps intersection-free.
No cruzar los cables de conexión al balasto con los de
conexión del balasto a la lámpara.
Due to the fact that remote control receivers are not selective, interference can be produced if the light from the
NCORUTGCEJVJGO+PVJKUECUGVJGWUGQHQRVKEſNVGTUUKVWated in the receivers or infrared systems with a frequency
higher than 400KHz is recommended.
Debido a que los receptores de los telemandos no son
selectivos, pueden producirse interferencias si la luz de
las lámparas llega a los mismos, en tal caso, se recoOKGPFCGNWUQFGſNVTQUÎRVKEQUUKVWCFQUGPNQUTGEGRVQres, o bien, sistemas de infrarrojos con frecuencia superior a 400KHz.
5YKVEJGUHQTRTQVGEVKQP
Interruptores de protección
Each group of electronic ballasts must be protected by
a magnetothermical circuit breaker and a differential dedicated circuit breaker.
The electronic ballasts are resistant to transient overXQNVCIGU URGEKſGF KP TGIWNCVKQPU CPF OWUV DG KPUVCNNGF
on separate circuits separated from other inductive loads
(inductive ballasts, motors, fans etc. ....)
Cada grupo de balastos electrónicos debe estar protegido por un interruptor magnetotérmico y un diferencial de
uso exclusivo. Los balastos electrónicos son resistentes a
NCUUQDTGVGPUKQPGUVTCPUKVQTKCUGURGEKſECFCUGPPQTOCVKva, y deben ser instalados en circuitos independientes separados de otras cargas inductivas (balastos inductivos,
motores ventiladores etc….).
&KHHGTGPVKCNEKTEWKVDTGCMGT
Interruptor diferencial
6JGHWPEVKQPQHVJGCPVKKPVGTHGTGPEGſNVGTUKPGNGEVTQPKE
ballasts is to divert interference to the earth wire as leakage current. ELT’S ballasts have a leakage current of less
than 0,5 mA.
.QUſNVTQUFGUWRTGUKÎPFGKPVGTHGTGPEKCUFGNQUDCNCUtos electrónicos, tienen la función de derivar a tierra las
interferencias en forma de corriente de fuga. Los balastos
de ELT poseen una corriente de fuga menor de 0,5 mA.
In triphase systems:
&KUVTKDWVG VJG NKIJV ſZVWTGU GSWCNN[ DGVYGGP VJG VJTGG
phases. The leakage currents will compensate each other.
En redes trifásicas:
Repartir las luminarias equilibradamente entre las tres
fases. Las corrientes de fuga se compensan.
In monophase systems:
The use of a maximum of 35 electronic ballasts with
each circuit breaker with 30 mA sensitivity is recommenden.
En redes monofásicas:
Se recomienda un máximo de 35 balastos electrónicos
con cada interruptor de sensibilidad 30 mA.
#WVQOCVKEEKTEWKVDTGCMGT
The ignition of lamps with electronic ballasts is simultaneous. At the moment of connection, the equipment’s
capacitors create a strong pulse of current of very short
duration, this is called Inrush current. The installation of a
maximum number of ballasts depending on the type and
characteristics of the magnetothermical protection is recommended. See table.
1
N
2
N
164
Interruptor automático
El encendido de las lámparas con balastos electrónicos
es simultáneo. En el instante de la conexión, los condensadores del equipo crean un fuerte pulso de corriente,
aunque de muy corta duración, es la llamada Inrush current. Se recomienda la colocación de un número máximo
de balastos según el tipo y las características del magnetotérmico de protección. Ver tabla.
www.elt.es
Maximum number of equipments for each switch
Número de balastos por interruptor automático y
diferencial
/CZPQHGSWKROGPVRGTUYKVEJ
Inrush current (*)
/CZKOWONCORYCVVCIGUCNNQYGF
KPVJGDCNNCUV
Potencia máxima en lámpara
admisible en el balasto
Nº de equipos máx. por cada interruptor
Inrush current (*)
+2GCM
I. Pico
Type B
Tipo B
6KOG
Time
Type C
Tipo C
&KHHGTGPVKCN
Diferencial
A
μS
10A
16A
10A
16A
30mA
ŭ9
20
200
20
28
29
40
35
55 ÷ 80 W
23
240
13
20
21
30
35
80 ÷ 116 W
35
200
10
13
14
22
35
116 ÷ 160 W
36
240
-
8
8
14
35
(*) Values of reference of “Inrush Current” according to the maximum lamp
wattages allowed in the ballast. Don’t hesitate to require more details of a
concrete model to ourTechnical Department.
(*) Valores de referencia de Inrush Current según la potencia máxima en
lámpara admisible en el balasto. Para conocer los datos de un modelo
concreto pongase en contacto con nuestro Departamento Técnico.
BALLASTS REACTION AND PROTECTION SYSTEM / RESPUESTA DEL BALASTO Y SISTEMA DE PROTECCIÓN
6[RGQHDCNNCUVU
Tipos de balastos
5GTKGU$'ZZ
5GTKGU$'ZZ
5GTKGU$'ZZ
#WVQOCVKE
TGUVTKMGCHVGT
TGNCORKPI
Reencendido
automático al
reemplazar
una lámpara
YES / SI
YES / SI
YES / SI
5GTKGU$'
and / y BE 414-T5-2
YES / SI
5GTKGU$'ZZ65
YES / SI
Response to an exhausted lamp
Respuesta ante una lámpara agotada
Preheating of the cathodes, generation of high voltage
pulse and go to standby
Precaldea cátodos, genera impulso de alta tensión y
pasa a stand-by
Preheating of the cathodes, generation of high voltage
pulse and go to standby
Precaldea cátodos, genera impulso de alta tensión y
pasa a stand-by
Preheating of the cathodes, generation of high voltage
pulse and go to standby
Precaldea cátodos, genera impulso de alta tensión y
pasa a stand-by
Preheating of the cathodes, generation of high voltage
pulse and go to standby
Precaldea cátodos, genera impulso de alta tensión y
pasa a stand-by
Response to a
Response to
NCEMQHNCORCPF
OKETQEWVUQHVJG
ECVJQFGUYKVJQWV
supply voltage
EQPVKPWKV[
(0,01 a 0,2”)
Respuesta ante la
falta de una
lámpara o
ausencia de
cátodos
Respuesta ante
microcortes
de la tensión
(0,01 a 0,2”)
Response to a lamp
UJQTVEKTEWKV
Respuesta ante cortocircuito de
una lámpara
Reignition
Turn off the
other lamps
Reenciende
Enciende el resto
de lámparas
Reignition
Turn off the
other lamps
Reenciende
Enciende el resto
de lámparas
Reignition
Turn off the
other lamps
Reenciende
Enciende el resto
de lámparas
Reignition
Turn off the
other lamps
Reenciende
Enciende el resto
de lámparas
Stand-by
Stand-by
Stand-by
Stand-by
Reignition
Stand-by
Stand-by
Stand-by
Reenciende
5GTKGU$'Z6
YES / SI
5GTKGU$'ZZ
YES / SI
5GTKGU$'6
and / y BE 275
NO
Preheating of the cathodes, generation of high voltage
pulse and go to standby
Precaldea cátodos, genera impulso de alta tensión y
pasa a stand-by
Preheating of the cathodes, generation of high voltage
pulse, repeats 3 times and goes to standby
Precaldea cátodos, genera impulso de alta tensión,
repite 3 veces y pasa a stand-by
Preheating of the cathodes, generation of high voltage
pulse, repeats 3 times and goes to standby
Precaldea cátodos, genera impulso de alta tensión,
repite 3 veces y pasa a stand-by
Stand-by
Stand-by
Stand-by
Reignition
Turn off the
other lamps
Reenciende
Enciende el resto
de lámparas
Reignition
Turn off the
other lamps
Reenciende
Enciende el resto
de lámparas
Stand-by
Stand-by
The process of lamp ignition with electronic ballasts consists in a
period of cathode preheating, approximately 1,5 seconds, followed by
a high-voltage pulse.
Stand-by: The electronic ballast is in protection situation. The
disconnection and connection of the net feeding will make reactivate
again the equipment.
In case of fortuitous connection to tension lower or superior to the
allowed one, the ballast might turn off the lamps as a protection
measure.
A situation maintained in these conditions can cause the damage of
the equipment.
El proceso de encendido de las lámparas con balastos
electrónicos consiste en un periodo de precaldeo de los cátodos,
aproximadamente 1,5 segundos, seguido de un impulso de alta
tensión.
Stand-by: El balasto electrónico se encuentra en situación de
protección. La desconexión y conexión de la alimentación hará
reactivar de nuevo al equipo.
En caso de conexión fortuita a tensión inferior o superior a la
permitida, el balasto podría apagar las lámparas como medida de
protección.
Una situación mantenida en estas condiciones puede causar la
avería del equipo.
Data are subject to change without prior notice
.QUFCVQUGUVCPUWLGVQUCOQFKſECEKÎPUKPRTGXKQCXKUQ
www.elt.es
165
/CPWHCEVWTKPIUVCPFCTFU
Normas de fabricación
'.6ŏUGNGEVTQPKEDCNNCUVUHQTƀWQTGUEGPVNCORUCTGOCPWfactured in accordance with the following standards:
EN 61347-1
Auxiliary equipment for lamps. Part 1:
general and safety requirements.
Las normas según las cuales están fabricadas los balasVQUGNGEVTÎPKEQUFG'.6RCTCN¶ORCTCUƀWQTGUEGPVGUUQP
EN 61347-1
Aparatos auxiliares para lámparas.
Parte 1: requisitos generales y de seguridad.
EN 61347-2-3
(EN 60928)
Particular requirements for alternating
current powered electronic ballasts for
ƀWQTGUEGPVNCORU
EN 61347-2-3
(EN 60928)
Requisitos particulares para balastos
electrónicos alimentados en corriente alVGTPCRCTCN¶ORCTCUƀWQTGUEGPVGU
EN 61347-2-5
(EN 60924)
Particular requirements for direct current
powered electronic ballasts for lighting in
public transport.
EN 61347-2-5
(EN 60924)
Requisitos particulares para balastos
electrónicos alimentadas en corriente
continua para iluminación en transportes
públicos.
'0 $CNNCUVU HQT VWDWNCT ƀWQTGUEGPV NCORU
Operation requirements.
'0 $CNCUVQURCTCN¶ORCTCUƀWQTGUEGPVGUVWbulares. Prescripciones de funcionamiento.
#05+%
5RGEKſECVKQPUHQTƀWQTGUEGPVNCORU
#05+%
'URGEKſECEKQPGU RCTC N¶ORCTCU ƀWQTGUcentes.
ANSI C 78
Physical and electrical characteristics for
ƀWQTGUEGPVNCORU
ANSI C 78
Características físicas y eléctricas para
N¶ORCTCUƀWQTGUEGPVGU
EN 50294
Method of measuring the total input power in the ballast-lamp circuit.
EN 50294
Método de medida de la potencia total de
entrada de los circuitos balasto-lámpara.
EN 60929
Alternating current powered electronic
DCNNCUVU HQT VWDWNCT ƀWQTGUEGPV NCORU
Operating requirements.
EN 60929
Balastos electrónicos alimentados en
EQTTKGPVG CNVGTPC RCTC N¶ORCTCU ƀWQTGUcentes tubulares. Prescripciones de funcionamiento.
Particular requirements for ballasts for
ƀWQTGUEGPVNCORU
EN 61347-2-8
'0
Prescripciones particulares para balasVQURCTCN¶ORCTCUƀWQTGUEGPVGU
EN 60925
Direct current powered electronic balNCUVUHQTVWDWNCTƀWQTGUEGPVNCORU1RGTating requirements.
EN 60925
Balastos electrónicos alimentados en
EQTTKGPVGEQPVKPWCRCTCN¶ORCTCUƀWQTGUcentes tubulares. Prescripciones de funcionamiento.
'0 6WDWNCT ƀWQTGUEGPV NCORU QH IGPGTCN
lighting.
'0 .¶ORCTCU VWDWNCTGU ƀWQTGUEGPVGU RCTC
iluminación general.
'0 5KPING DCUG ƀWQTGUEGPV NCORU 5GEWTKV[
and operating requirements.
'0 .¶ORCTCUƀWQTGUEGPVGUFGECUSWKNNQÕPKco. Prescripciones de seguridad y funcionamiento.
EN 55015
Limits and measuring methods of the
relative characteristics of radio electrical
disturbance of lighting and similar equipment.
EN 55015
Límites y métodos de medida de las características relativas a la perturbación
radioeléctrica de los equipos de iluminación y similares.
EN 61000-3-2
Electromagnetic compatibility (EMC).
Part 3: Limits.
Section 2: Limits for the harmonic current emissions (equipment with an input
current equal to or lower than 16 A per
phase).
EN 61000-3-2
Compatibilidad electromagnética (CEM).
Parte 3: Límites.
Sección 2: Límites para las emisiones
de corriente armónica (equipos con corriente de entrada menor o igual que 16
A por fase).
EN 61000-3-3
Electromagnetic compatibility (EMC).
Part 3: Limits.
Section 3: Limitation of voltage HuetuaVKQPUCPFƀKEMGT.QYXQNVCIGUWRRN[U[Utems for equipments with rated current
ŭ#
EN 61000-3-3
Compatibilidad electromagnética (CEM).
Parte 3: Límites.
5GEEKÎP.ÈOKVCEKÎPFGNCUƀWEVWCEKQPGUFGVGPUKÎP[FGNƀKEMGTGPTGFGUFG
baja tensión para equipos con corriente
FGGPVTCFCŭ#
EN 61347-2-8
'0 EN 61547
Equipment for general lighting use. EMC
immunity requirements.
6JGVGUVUVQGPUWTGVJGHWNſNOGPVQHVJGCRRNKECDNGTGIWNCtions for the emission of radio-interference, harmonics and
immunity are carried out on the device made up of the ballast, lamp, luminaire and wiring.
EN 61547
Equipos para alumbrado de uso general.
Requisitos de inmunidad - CEM
Los ensayos para el cumplimiento con las normativas aplicables de emisión de radio-interferencias, armónicos e inmunidad, deben ser realizados al conjunto formado por balasto,
lámpara, luminaria y cableado.
166
www.elt.es
DISCHARGE INDEX
ÍNDICE DESCARGA
Electronic ballasts for metal halide lamps - Ignition
voltage 5kV
Balastos electrónicos para lámparas de halogenuros
metálicos - Tensión de encendido 5kV .................. 171
Electronic ballasts for metal halide lamps with terminal
cover - Ignition voltage 5kV
Balastos electrónicos para lámparas de halogenuros
metálicos con cubre bornas - Tensión de
encendido 5kV ........................................................ 172
Electronic ballasts for metal halide lamps with
terminal cover - Ignition voltage 5kV - Metal
Balasto electrónico para lámparas de halogenuros
metálicos con cubre bornas - Tensión de
encendido 5kV - Metal ............................................ 173
Electronic ballasts, encapsulated type for high pressure
sodium vapour lamps
Balastos electrónicos, tipo encapsulado
para lámparas de vapor de sodio alta presión ....... 174
Electronic ballasts with power control SMI for high
pressure sodium vapour lamps encapsulated type
Balastos electrónicos con regulación de potencia SMI
para lámparas de vapor de sodio alta presión
Tipo encapsulado ................................................... 175
Electronic ballasts for metal halide lamps
encapsulated type
Balastos electrónicos para lámparas de halogenuros
metálicos. Tipo encapsulado .................................. 177
Electronic ballasts with power control SMI for metal
halide lamps. Encapsulated type
Balastos electrónicos con regulación de potencia SMI
para lámparas de halogenuros metálicos
Tipo encapsulado .................................................. 178
Ballasts for mercury vapour lamps
Reactancias para lámparas de vapor
de mercurio............................................................. 183
Ballasts for mercury vapour lamps
Reactancias para lámparas de vapor
de mercurio............................................................. 184
Ballasts for mercury vapour lamps
Reactancias para lámparas de vapor
de mercurio............................................................. 185
Ballasts for mercury vapour lamps. Reduced section
Reactancias para lámparas de vapor de mercurio.
Sección reducida ................................................... 186
Ballasts of Class II for mercury vapour lamps.
High power factor IP40
Reactancias para lámparas de vapor de mercurio
Clase II IP40. Alto factor de potencia ..................... 187
Encapsulated ballasts of class II for mercury vapour
lamps. High power factor IP54
Reactancias encapsuladas para lámparas de vapor de
mercurio. Clase II IP54. Alto factor de potencia .... 188
Ballasts bi-Power system for mercury vapour lamps
Reactancias para lámparas de Vapor de Mercurio
Doble Nivel de Potencia ......................................... 189
Ballasts bi-power system for mercury vapour lamps
Class II IP54
Reactancias para lámparas de vapor de mercurio
Clase II doble nivel de potencia IP54 ..................... 190
Ballasts for high pressure sodium vapour lamps
Reactancias para lámparas de vapor de sodio a alta
presión .................................................................... 191
Electronic ballasts with power control depending on main
voltage encapsulated type for high pressure sodium
vapour lamps
Balastos electrónicos con regulación de potencia,
dependiente de tensión de alimentación tipo
encapsulado para lámparas de vapor
de sodio alta presión .............................................. 180
Ballasts for high pressure sodium vapour lamps
Reactancias para lámparas de vapor de sodio a alta
presión ................................................................... 192
Electronic ballasts with power control depending on main
voltage encapsulated type for metal halide lamps
Balastos electrónicos con regulación de potencia,
dependiente de tensión de alimentación tipo
encapsulado para lámparas de
halogenuros metálicos............................................ 181
Ballasts for high pressure sodium vapour lamps
Reactancias para lámparas de vapor de sodio a alta
presión ................................................................... 194
Ballasts for mercury vapour lamps
Reactancias para lámparas de vapor
de mercurio............................................................. 182
Ballasts for high pressure sodium vapour lamps
Reactancias para lámparas de vapor de sodio a alta
presión ................................................................... 193
Ballasts for high pressure sodium vapour lamps
Reduced section
Reactancias para lámparas de vapor de sodio a alta
presión. Sección reducida ...................................... 195
168
www.elt.es
Encapsulated ballasts for high pressure sodium vapour
lamps
Reactancias encapsuladas para lámparas de vapor
de sodio a alta presión .......................................... 196
Compact assemblies for high pressure sodium vapour
lamps Class II IP54. High power factor
Equipos completos para lámparas de vapor de sodio alta
presión Clase II IP54. Alto factor de potencia ....... 207
Assemblies for high pressure sodium vapour lamps
Equipos completos para lámparas de vapor de sodio a
alta presión ............................................................ 197
Ballasts for metal halide lamps
Reactancias para lámparas de
halogenuros metálicos .......................................... 208
Compact assemblies for high pressure sodium vapour
lamps
Equipos completos enchufables para lámparas
de vapor de sodio a alta presión ........................... 198
Ballasts for metal halide lamps
Reactancias para lámparas de
halogenuros metálicos .......................................... 209
Compact assemblies for high pressure sodium vapour
and metal halide lamps. Reduced section
Equipos completos enchufables para lámparas de vapor
de sodio alta presión y halogenuros metálicos.
Sección reducida ................................................... 199
Control gear for high pressure sodium lamps in IP65 box
Equipos completos en cofre IP65 para lámparas de
vapor de sodio alta presión ................................... 200
Ballasts for high pressure sodium vapour lamps
bi-power system
Reactancias para lámparas de vapor de sodio alta
presión doble nivel de potencia ............................. 201
Ballasts for high pressure sodium vapour lamps
bi-power system SMI
Reactancias para lámparas de vapor de sodio alta
presión doble nivel de potencia SMI ...................... 202
Ballasts for high pressure sodium vapour lamps bi-power
system SMI with thermal protection
Reactancias para lámparas de vapor de sodio alta
presión. Doble nivel de potencia SMI con protección
VÃTOKEC ................................................................... 203
Ballasts for high pressure sodium vapour lamps
Bi-power system
Reactancias para lámparas de vapor de sodio alta
presión. Doble nivel de potencia ........................... 204
Ballasts for high pressure sodium vapour lamps
Bi-power system IP54
Reactancias para lámparas de vapor de sodio alta
presión Clase II. Doble nivel de potencia IP54 ...... 205
Compact assemblies for high pressure sodium vapour
lamps Class II IP40. High power factor
Equipos completos para lámparas de vapor de sodio alta
presión IP40 Clase II. Alto factor de potencia ...... 206
www.elt.es
Ballasts for metal halide lamps
Reactancias para lámparas de
halogenuros metálicos .......................................... 210
Ballasts for metal halide lamps
Reactancias para lámparas de
halogenuros metálicos
............................................................................... 211
Ballasts for metal halide lamps. Reduced section
Reactancias para lámparas de halogenuros metálicos
Sección reducida ................................................... 212
Ballasts for metal halide lamps. High power
Reactancias para lámparas de halogenuros metálicos.
Altas potencias ...................................................... 213
Encapsulated ballasts for metal halide lamps
Reactancias encapsuladas para lámparas de
halogenuros metálicos ........................................... 214
Assemblies for metal halide lamps
Equipos completos para lámparas de halogenuros
metálicos ............................................................... 215
Assemblies ARCE for metal halide lamps
Equipos completos enchufables ARCE para lámparas
de halogenuros metálicos ...................................... 216
Compact assemblies for metal halide lamps Class II IP40
Equipos completos para lámparas de halogenuros
metálicos. IP40 Clase II ......................................... 217
Compact assemblies for metal halide lamps. Class II.
Reduced section IP40
Equipos completos para lámparas de halogenuros
metálicos. Clase II. Sección reducida IP40 ........... 218
Compact assemblies for metal halide. Clase II IP54
Equipos completos para lámparas de halogenuros
metálicos. Clase II IP54 ......................................... 219
169
Ballasts for metal halide Clase II high power factor. Two
hoses
Reactancias para lámparas de halogenuros metálicos
Clase II alto factor de potencia.
Doble manguera ................................................... 220
TECHNICAL INFORMATION
INFORMACIÓN TÉCNICA
Electromagnetic control gear metal halide lamps
mounted in IP65 box
Equipos completos en cofre IP65 para halogenuros
metálicos .............................................................. 221
Types of ELT ballasts
Tipos de reactancias ELT ....................................... 235
Ignitor selection table
Tabla para la selección de arrancadores ............. 222
Ignitor for high pressure sodium vapour and metal halide
lamps
Arrancador para lámparas de vapor de sodio A.P y
halogenuros metálicos ........................................... 223
Ignitor for high pressure sodium vapour and metal halide
lamps
Arrancador para lámparas de vapor de sodio A.P y
halogenuros metálicos ........................................... 224
Ignitor for low pressure sodium and metal halide
lamps-0,8 kV
Arrancador para lámparas de sodio B.P. y
halogenuros metálicos de 0,8 kV .......................... 225
Ignitor for metal halide lamps - 1,2 kV
Arrancador para lámparas de halogenuros metálicos 1,2 kV .................................................................... 226
Ignitor for high pressure sodium and metal halide
Arrancador para lámparas de vapor de sodio A.P. y
halogenuros metalicos ........................................... 227
Ignitor for metal halide lamps
Arrancador para lámparas de
halogenuros metálicos ........................................... 228
Ballasts for discharge lamps
Reactancias para lámparas de descarga .............. 233
Bi-power system ballasts for energy saving
Reactancias para ahorro de energía doble nivel de
potencia ................................................................. 236
Timed bi-power system ballasts
(Without command wires -SM-)
Reactancias de doble nivel de potencia temporizadas
(Sin línea de mando - SM-) ................................... 238
By-power system control gears timed with astronomical
response - SMI
Reactancias de doble nivel de potencia temporizadas
con control astronómico - SMI ............................... 239
Ballasts for discharge lamps class II
Balastos para lámparas de descarga clase II ........ 241
Ballasts with thermal protection
4GCEVCPEKCUEQPRTQVGEEKÎPVÃTOKEC...................... 243
Ignitor for discharge lamps
Arrancadores para lámparas de descarga ............ 244
Installation recommendations
Recomendaciones de instalación .......................... 250
Manufacturing standards
Normas de fabricación ........................................... 251
'PGTI[GHſEKGPE[TGSWKTGOGPVUHQT*+&NCORU
4GSWKUKVQUFGGſEKGPEKCGPGTIÃVKECFGNQUEQORQPGPVGU
para lámparas de descarga ................................... 253
Ignitor for metal halide lamps
Arrancador para lámparas de
halogenuros metálicos ........................................... 229
Capacitors for power factor correction.
Characteristics and dimensions
Condensadores para correción del factor de potencia.
Características y dimensiones ............................... 230
Capacities for power factor correction
Capacidades para corregir el factor de potencia ... 231
Discharge lamps
Lámparas de descarga .......................................... 232
170
www.elt.es
Homologaciones
Tensión
Factor de
Frecuencia Intensidad
de
Longitud
potencia
de función
encendido máx. a
lámp.
Approvals
Lámpara
Power
factor
Uds. por caja
Ref. No.
Current
Max.
ECDNG
length
to lamp.
BE-MH-5-s/t
220-240V
50-60Hz
7PKVURGTDQZ
Modelo
Lamp
+IPKVKQP
voltage
Sección del conductor
Model
1RGTCVKPI
HTGSWGPE[
%CDNGUGEVKQP
150W
Temp. funcionamiento
100W
1RGTCVKPIVGOR
35-50-70W
/CZVGORCVVERQKPV
20W
Temp.máx. envolvente
'NGEVTQPKEDCNNCUVUHQTOGVCNJCNKFGNCORU+IPKVKQPXQNVCIGM8
Balastos electrónicos para lámparas de halogenuros
metálicos - Tensión de encendido 5kV
Hz
A
Kv
m
NJ
tc (°C)
ta (°C)
mm2
9313050
20W HID
135
0,11
5
2
> 0,9
75
-15... +60
0,50... 1,5
20
01
*BE 135-MH-5 s/t
9313051
35W HID
173
0,20... 0,18
5
2
0,95
80
-20... +65
0,75... 2,5
16
01
*BE 150-MH-5 s/t
9313052
50W HID
173
0,26... 0,24
5
2
0,95
80
-20... +60
0,75... 2,5
16
01
*BE 170-MH-5 s/t
9313053
70W HID
173
0,36... 0,34
5
2
0,95
80
-20... +55
0,75... 2,5
16
01
*BE 1100-MH-5 s/t
9313054
100W HID
170
0,49... 0,45
5
2
0,98
75
-20... +50
0,75... 2,5
12
01
BE 1150-MH-5 s/t
9313055
150W HID
170
0,73... 0,67
5
4
0,98
85
-20... +45
0,75... 2,5
6
01
(1)
BE 120-MH-5 s/t
~ Potencia estabilizada en la lámpara.
~ Elimina las desviaciones de color debido a las variaciones de la tensión de red
y minimiza éstas cuando son debidas al envejecimiento de la lámpara o a las
tolerancias naturales en ellas.
`#NVCECNKFCFFGNW\VQVCNOGPVGNKDTGFGƀKEMGT
~ Pérdidas propias reducidas.
~ Alto factor de potencia.
~ Encendido controlado de la lámpara.
~ Tiempo corto de estabilización de la lámpara.
~ THD < 10%.
~ Indice EEI = A2.
~ Protecciones y seguridades:
~ Protección térmica.
~ Impulsos de sobretensión en red.
~ Cortocircuito en la lámpara.
~ Protección ante operación sin lámpara
`'HGEVQTGEVKſECFQTGPNCN¶ORCTC
~ Fin de vida de la lámpara.
~ Equipo para incorporar. Debe montarse en el interior de
caja o luminaria.
~ Grado de protección IP20.
~ Balasto electrónico compatible con el sistema de protección contra rayos e
impulsos en la entrada ITP pág. 90 y
www.elt.es\productos pdf\701000000.pdf.
~ Tensión permitida AC: 198-264V.
* Envolvente de aluminio.
(1) Excepto BE 120-MH-5 s/t - Tensión permitida AC: 198-254V.
~ Constant power control.
~ No colour temperatures deviation caused by supply voltage changes and
reduction of it when lamp eldness.
~ Excellent quality of light. Flicker-free.
~ Reduced own losses.
~ High power factor.
~ Controlled lamp ignition.
~ Short time period for lamp stabilisation.
~ Total harmonic distortion: < 10%.
~ EEI Index = A2.
~ Secured and protected:
~ Thermal protection.
~ Overvoltage control.
~ Lamp shortcircuit.
~ Protection against “no load” operation.
~ Rectifying effect.
~ End-of-life effect.
`$CNNCUVHQTDWKNVKPWUG6QDGKPUVCNNGFYKVJKPCDQZQTNKIJVKPIſZVWTG
~ IP20 protection.
~ Input transient, surge and strike protection device ITP is suitable for this driver
pag. 90 and www.elt.es\productos\pdf\701000000.pdf.
~ Permitted input voltage AC: 198-264V.
* Aluminium case.
(1) Except: BE-120-MH-5 s/t - Permitted input voltage AC: 198-254V.
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
20-35-50-70-150W
mains
N
130
100W
L
L
mains
N
EN-61347-2-12
EN-61000-3-2
EN-55015
EN-61547
www.elt.es
HI 100W
171
Tensión
Factor de
Frecuencia Intensidad
de
Longitud
potencia
de función
encendido máx. a
lámp.
Homologaciones
Lámpara
Approvals
Lamp
Power
factor
Uds. por caja
Modelo
Ref. No.
Current
Max.
ECDNG
length
to lamp.
7PKVURGTDQZ
Model
1RGTCVKPI
HTGSWGPE[
+IPKVKQP
voltage
Sección del conductor
150W
%CDNGUGEVKQP
100W
Temp. funcionamiento
35-50-70W
1RGTCVKPIVGOR
20W
Temp.máx. envolvente
'NGEVTQPKEDCNNCUVUHQTOGVCNJCNKFGNCORUYKVJVGTOKPCN
EQXGT+IPKVKQPXQNVCIGM8
Balastos electrónicos para lámparas de halogenuros
metálicos con cubre bornas - Tensión de encendido 5kV
/CZVGORCVVERQKPV
BE-MH-5-c/t
220-240V
50-60Hz
Hz
A
Kv
m
NJ
tc (°C)
ta (°C)
mm2
9313060
20W HID
135
0,11
5
2
> 0,9
75
-15... +60
0,50... 1,5
10
01
BE 135-MH-5 c/t
9313061
35W HID
173
0,20... 0,18
5
2
0,95
75
-20... +65
0,75... 2,5
6
01
BE 150-MH-5 c/t
9313062
50W HID
173
0,26... 0,24
5
2
0,95
70
-20... +60
0,75... 2,5
6
01
BE 170-MH-5 c/t
9313063
70W HID
173
0,36... 0,34
5
2
0,95
75
-20... +55
0,75... 2,5
6
01
BE 1100-MH-5 c/t
9313064
100W HID
170
0,49... 0,45
5
2
0,98
65
-20... +50
0,75... 2,5
7
01
BE 1150-MH-5 c/t
9313065
150W HID
170
0,73... 0,67
5
4
0,98
85
-20... +45
0,75... 2,5
11
01
(1)
BE 120-MH-5 c/t
~ Constant power control.
~ No colour temperatures deviation caused by supply voltage changes and
reduction of it when lamp eldness.
~ Excellent quality of light. Flicker-free.
~ Reduced own losses.
~ High power factor.
~ Controlled lamp ignition.
~ Short time period for lamp stabilisation.
~ Total harmonic distortion: < 10%.
~ EEI Index = A2
~ Secured and protected:
~ Thermal protection.
~ Overvoltage control.
~ Lamp shortcircuit.
~ Protection against “no load” operation.
~ Rectifying effect.
~ End-of-life effect.
~ Independent use for indoor use only.
~ IP20 protection.
~ Input transient, surge and strike protection device ITP is suitable for this
driver pag. 90 and www.elt.es\productos\pdf\701000000.pdf.
~ Permitted input voltage AC: 198-264V.
~ Potencia estabilizada en la lámpara.
~ Elimina las desviaciones de color debido a las variaciones de la tensión
de red y minimiza éstas cuando son debidas al envejecimiento de la
lámpara o a las tolerancias naturales en ellas.
`#NVCECNKFCFFGNW\VQVCNOGPVGNKDTGFGƀKEMGT
~ Pérdidas propias reducidas.
~ Alto factor de potencia.
~ Encendido controlado de la lámpara.
~ Tiempo corto de estabilización de la lámpara.
~ THD < 10%.
~ Indice EEI = A2.
~ Protecciones y seguridades:
~ Protección térmica.
~ Impulsos de sobretensión en red.
~ Cortocircuito en la lámpara.
~ Protección ante operación sin lámpara
`'HGEVQTGEVKſECFQTGPNCN¶ORCTC
~ Fin de vida de la lámpara.
~ Para uso independiente en interior.
~ Grado de protección IP20.
~ Balasto electrónico compatible con el sistema de protección contra rayos
e impulsos en la entrada ITP pág. 90 y
www.elt.es\productos pdf\701000000.pdf.
~ Tensión permitida AC: 198-264V.
(1) Excepto BE 120-MH-5 c/t - Tensión permitida AC: 198-254V.
(1) Except: BE-120-MH-5 c/t - Permitted input voltage AC: 198-254V.
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
20-35-50-70-150W
mains
N
130
100W
L
L
mains
N
EN-61347-2-12
EN-61000-3-2
EN-55015
EN-61547
HI 100W
172
www.elt.es
'NGEVTQPKEDCNNCUVUHQTOGVCNJCNKFGNCORUYKVJ
VGTOKPCNEQXGT+IPKVKQPXQNVCIGM8/GVCN
Balasto electrónico para lámparas de halogenuros metálicos
con cubre bornas - Tensión de encendido 5kV - Metal.
BE-150W-MH
220-240V
DC/AC 50-60Hz
36
150 W
88
Modelo
BE 1150-MH
Ref. No.
9313022
Lamp
Lámpara
150W HID
Current
+IPKVKQP
voltage
Max.
ECDNG
length
to lamp.
Power
factor
Max.temp.
CVVERQKPV
Tensión
Factor de Temp.máx.
Frecuencia Intensidad
de
Longitud
potencia envolvente
de función
encendido máx. a
lámp.
1RGTCVKPI
temp.
Temp.
funcionamiento
Hz
A
Kv
m
NJ
tc (°C)
ta (°C)
120
0,70
5
2
0,98
85
-15... +50
7PKVU
RGTDQZ
Uds.
por caja
20
Homologaciones
Model
1RGTCVKPI
HTGSWGPE[
Approvals
180
190
01
~ Constant power control.
~ No colour temperatures deviation caused by supply voltage
changes and reduction of aging of the lamp.
`'ZEGNNGPVSWCNKV[QHNKIJV6JGNKIJVKUƀKEMGTHTGG
~ Reduced own losses.
~ High power factor.
~ Controlled lamp ignition.
~ Short time period for lamp stabilisation.
~ EEI Index = A2.
~ Secured and protected:
~ Thermal protection.
~ Overvoltage control.
~ Lamp shortcircuit.
~ Rectifying effect.
~ End-of-life effect.
~ Independent use with terminal cover. Can be installed separately of
the luminaire. For indoor use only.
~ IP20 protection.
~ Connectors:
~ Mains: 0,5-1,5 mm2 .
~ Lamp: 0,5-2,5 mm2 .
~ Input transient, surge and strike protection device ITP is suitable for
this driver pag. 90 and www.elt.es\productos\pdf\701000000.pdf.
~ Potencia estabilizada en la lámpara.
~ Elimina las desviaciones de color debido a las variaciones
de la tensión de red y minimiza éstas cuando son debidas al
envejecimiento de la lámpara o a las tolerancias naturales en ellas.
`#NVCECNKFCFFGNW\VQVCNOGPVGNKDTGFGƀKEMGT
~ Pérdidas propias reducidas.
~ Alto factor de potencia.
~ Encendido controlado de la lámpara.
~ Tiempo corto de estabilización de la lámpara.
~ Indice EEI = A2.
~ Protecciones y seguridades:
~ Protección térmica.
~ Impulsos de sobretensión en red.
~ Cortocircuito en la lámpara.
`'HGEVQTGEVKſECFQTGPNCN¶ORCTC
~ Fin de vida de la lámpara.
~ Equipo independiente con cubre bornes. Puede montarse
separadamente en el exterior de la luminaria. Uso interno.
~ Grado de protección IP20.
~ Conectores de conexión:
~ Red: 0,5-1,5 mm2 .
~ Lámpara: 0,5-2,5 mm2 .
~ Balasto electrónico compatible con el sistema de protección contra
rayos e impulsos en la entrada ITP pág. 90 y
www.elt.es\productos pdf\701000000.pdf.
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
110
MA
KEEUR
EN-61347-2-12 Safety / Seguridad
EN-61000-3-2 Harmonics / Armónicos
EN-55015 Interferences / Interferencias
EN-61547 EMC Immunity / Inmunidad CEM
www.elt.es
LAMP
173
L
N
'NGEVTQPKEDCNNCUVUGPECRUWNCVGFV[RGHQTJKIJRTGUUWTG
UQFKWOXCRQWTNCORU
Balastos electrónicos, tipo encapsulado para lámparas de
vapor de sodio alta presión
38,3
154,4
144,6
Homologaciones
Índice
Approvals
Index
Tensión
Factor de
Frecuencia Intensidad
de
Longitud
potencia
de función
encendido máx. a
lámp.
Uds. por caja
Lámpara
Power
factor
7PKVURGTDQZ
Ref. No.
Current
Max.
ECDNG
length
to lamp.
Temp. funcionamiento
Modelo
Lamp
+IPKVKQP
voltage
1RGTCVKPIVGOR
Model
1RGTCVKPI
HTGSWGPE[
Temp.máx. envolvente
78,5 93,4
/CZVGORCVVERQKPV
BE-EN-HPS
220-240V
50-60Hz
Hz
A
Kv
m
NJ
tc (°C)
ta (°C)
BE 150-EN-MH
9616123
50W MH/HPS
172
0,25
5
1,5
0,98
85
-20... +55
8
A2
01
BE 170-EN-MH
9616145
70W MH/HPS
172
0,35
5
1,5
0,98
85
-20... +55
8
A2
01
BE 1100-EN-MH
9616165
100W MH/HPS
172
0,49
5
1,5
0,98
85
-20... +55
8
A2
01
BE 1150-EN-MH
9616105
150W MH/HPS
172
0,73
5
1,5
0,98
85
-20... +55
8
A2
01
5RGEKſECVKQPU
~ Built-in ballast, protection index IP-20.
~ Suitable for street lighting applications.
~ Encapsulated for components protection.
~ No electrolytic capacitors: long life up to 80.000 hours.
~ Reduced own losses EEI=A2.
~ Stabilized lamp power.
~ Low frequency operation (172Hz).
~ Pulse time limited to 25 minutes, pulse-pause technology.
~ Permitted input voltage AC: 198-264V.
~ Conductor section: 0,5-2,5 mm2 .
EEI
Características:
~ Equipos a incorporar, índice de protección IP-20.
~ Adecuadas para aplicaciones de alumbrado de exterior.
~ Encapsuladas para la protección de los componentes.
~ Sin condensadores electrolíticos: vida prolongada del equipo hasta
80.000 horas.
~ Reducidas pérdidas propias EEI=A2.
~ Potencia estabilizada en lámpara.
~ Operación en baja frecuencia (172Hz).
~ Tiempo de impulso limitado a 25 minutos, tecnología pulso-pausa.
~ Tensión permitida AC: 198-264V.
~ Sección del conductor: 0,5-2,5 mm2 .
2TQVGEVKQPU
~ Enhanced protection against surge pulses: 4Kv to ground, 6Kv
between phases.
~ With thermal protection.
~ Protected against rectifying effect and end-of-life effect.
~ Protected against short circuit in lamp.
~ Input transient, surge and strike protection device ITP is suitable for
this driver pag. 90 and www.elt.es\productos\pdf\701000000.pdf.
Protecciones:
~ Protección reforzada contra impulsos de sobretensión en red: 4Kv
a tierra, 6Kv entre fases.
~ Protección térmica.
`2TQVGEEKÎPEQPVTCGHGEVQTGEVKſECFQT[ſPFGXKFC
~ Protección contra cortocircuito en lámpara.
~ Balasto electrónico compatible con el sistema de protección contra
rayos e impulsos en la entrada ITP pág. 90 y
www.elt.es\productos pdf\701000000.pdf.
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
No conectar
Red
Do not connect Mains
Lámpara
Lamp
120
6
L-N
N
L
EN-61347-2-12 Safety / Seguridad
EN-61000-3-2 Harmonics / Armónicos
EN-55015 Interferences / Interferencias
EN-61547 EMC Immunity / Inmunidad CEM
174
www.elt.es
Electronic ballasts with power control SMI for high pressure sodium
vapour lamps encapsulated type
Balastos electrónicos con regulación de potencia SMI para lámparas
de vapor de sodio alta presión
Tipo encapsulado
38,3
154,4
144,6
78,5 93,4
Homologaciones
Índice
Approvals
Index
Unidades por caja
Units per box
Temp. funcionamiento
Operating temp.
Temp.máx. envolvente
Factor de potencia
Max.temp. at tc point
Power factor
Longitud máx. a lámp.
Ahorro de potencia
Max. cable length to lamp.
Energy saving
Tensión de encendido
Intensidad
Lámpara
Ignition voltage
Lamp
Current
Modelo
Ref. No.
Frecuencia de función
Model
Operating frequency
SMI AND SMI2 TECHNOLOGY - WITHOUT COMMAND WIRES / TECNOLOGÍAS SMI Y SMI2 - SIN LÍNEA DE MANDO
Hz
A
Kv
%
m
NJ
tc °C
ta °C
BE 150-EN-MH-SMI
9616122
50W MH/HPS
172
0,25
5
30
1,5
0,98
85
-20... +55
8
A2
BE 150-EN-HPS-SMI2
9616125
50W HPS
172
0,25
5
20/40
1,5
0,98
85
-20... +55
8
A2
BE 170-EN-MH-SMI
9616142
70W MH/HPS
172
0,35
5
40
1,5
0,98
85
-20... +55
8
A2
BE 170-EN-HPS-SMI2
9616147
70 HPS
172
0,35
5
30/50
1,5
0,98
85
-20... +55
8
A2
BE 1100-EN-MH-SMI
9616162
100W MH/HPS
172
0,49
5
40
1,5
0,98
85
-20... +55
8
A2
01
BE 1100-EN-HPS-SMI2
9616166
100W HPS
172
0,49
5
30/50
1,5
0,98
85
-20... +55
8
A2
01
BE 1150-EN-MH-SMI
9616102
150W MH/HPS
172
0,73
5
40
1,5
0,98
85
-20... +55
8
A2
01
BE 1150-EN-HPS-SMI2
9616106
150W HPS
172
0,73
5
30/50
1,5
0,98
85
-20... +55
8
A2
01
5RGEKſECVKQPU
~ Built-in ballast, protection index IP-20.
~ Suitable for street lighting applications.
~ Encapsulated for components protection.
~ No electrolytic capacitors: long life up to 80.000 hours.
~ Reduced own losses EEI=A2.
~ Stabilized lamp power.
~ Reduction of the lamp power up to 20, 30, 40 or 50% and 50% of
NWOKPQWUƀWZ
~ The lamp is not dimmed until at least 15 minutes of operation.
~ Low frequency operation (172Hz).
~ Valid for lamps allowing dimming.
~ Pulse time limited to 25 minutes, pulse-pause technology.
~ Permitted input voltage AC: 198-264V.
~ Conductor section: 0,5-2,5 mm2 .
~ Input transient, surge and strike protection device ITP is suitable for
this driver pag. 90 and www.elt.es\productos\pdf\701000000.pdf.
EEI
01
Características:
~ Equipos a incorporar, índice de protección IP-20.
~ Adecuadas para aplicaciones de alumbrado de exterior.
~ Encapsuladas para la protección de los componentes.
~ Sin condensadores electrolíticos: vida prolongada del equipo hasta
80.000 horas.
~ Reducidas pérdidas propias EEI=A2.
~ Potencia estabilizada en lámpara.
~ Reducción de la potencia en lámpara hasta el 20, 30, 40 o 50% y
FGNƀWLQNWOKPQUQJCUVCGN
~ No se reduce la potencia en lámpara hasta al menos 15 minutos de
funcionamiento.
~ Operación en baja frecuencia (172Hz).
~ Válidas para las lámparas que admitan regulación.
~ Tiempo de impulso limitado a 25 minutos, tecnología pulso-pausa.
~ Tensión permitida AC: 198-264V.
~ Sección del conductor: 0,5-2,5 mm2 .
~ Balasto electrónico compatible con el sistema de protección contra
rayos e impulsos en la entrada ITP pág. 90 y
www.elt.es\productos pdf\701000000.pdf.
No conectar
Red
Do not connect Mains
120
6
L-N
N
EN-61347-2-12 Safety / Seguridad
EN-61000-3-2 Harmonics / Armónicos
EN-55015 Interferences / Interferencias
EN-61547 EMC Immunity / Inmunidad CEM
www.elt.es
01
175
L
Lámpara
Lamp
BE-EN
HPS-SMI
220-240V
50-60Hz
Protections:
~ Enhanced protection against surge pulses: 4Kv to ground, 6Kv
between phases.
~ With thermal protection.
~ Protected against rectifying effect and end-of-life effect.
~ Protected against short circuit in lamp.
Protecciones:
~ Protección reforzada contra impulsos de sobretensión en red: 4Kv
a tierra, 6Kv entre fases.
~ Protección térmica.
`2TQVGEEKÎPEQPVTCGHGEVQTGEVKſECFQT[ſPFGXKFC
~ Protección contra cortocircuito en lámpara.
SMI and SMI2 technologies of astronomical response:
~ Without command wires.
~ Automatic changeover to low level during the central period of the
night.
~ Optimized saving time for any night length.
Tecnologías SMI y SMI2 de respuesta astronómica:
~ No necesita línea de mando.
~ Ajuste automático del paso a nivel reducido para la parte central de
la noche.
`'ſEKGPEKCQRVKOK\CFCRCTCEWCNSWKGTFWTCEKÎPFGNCPQEJG
SMI
Response en Helsinki
Comportamiento en Helsinki
16
18
20
22
24
2
4
6
Response en Madrid
Comportamiento en Madrid
8
10 h.
18
January
Enero
20
22
24
2
4
6
8
10 h.
8
10 h.
January
Enero
100%
W Lamp
60%
W Lamp
(1)
December
Diciembre
December
Diciembre
Response en Helsinki
Comportamiento en Helsinki
SMI 2
16
18
20
22
24
2
4
6
Response en Madrid
Comportamiento en Madrid
8
10 h.
18
January
Enero
20
22
24
2
4
6
January
Enero
100%
W Lamp
70%
W Lamp
(2)
50%
W Lamp
(3)
December
Diciembre
December
Diciembre
Mod.9616122: 70%
Mod.9616125: 80%
(3)
Mod.9616125: 60%
(1)
(2)
Detailed explanation of the operation page 239
'ZRNKECEKÎPFGVCNNCFCFGNHWPEKQPCOKGPVQR¶IKPC
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
'ODCNCLG[RGUQR¶I[YYYGNVGURTQFWEVQUGODCNCLGA'.6RFH
176
www.elt.es
'NGEVTQPKEDCNNCUVUHQTOGVCNJCNKFGNCORUGPECRUWNCVGFV[RG
Balastos electrónicos para lámparas de halogenuros metálicos
Tipo encapsulado
BE-EN-MH
220-240V
50-60Hz
38,3
154,4
144,6
Homologaciones
Índice
Approvals
Index
Unidades por caja
7PKVURGTDQZ
Temp. funcionamiento
1RGTCVKPIVGOR
Temp.máx. envolvente
Factor de potencia
Tensión
Frecuencia Intensidad
de
de función
encendido
/CZVGORCVVERQKPV
Lámpara
+IPKVKQP
voltage
Power factor
Modelo
Lamp
Ref. No.
Current
Longitud máx. a lámp.
Model
1RGTCVKPI
HTGSWGPE[
/CZECDNGNGPIVJVQNCOR
78,5 93,4
Hz
A
Kv
m
NJ
tc °C
ta °C
BE 145-EN-MH
9616113
45W MH
172
0,23
5
1,5
0,98
85
-20... +55
8
EEI
A2
01
BE 150-EN-MH
9616123
50W MH/HPS
172
0,25
5
1,5
0,98
85
-20... +55
8
A2
01
BE 160-EN-MH
9616133
60W MH
172
0,30
5
1,5
0,98
85
-20... +55
8
A2
01
BE 170-EN-MH
9616145
70W MH/HPS
172
0,35
5
1,5
0,98
85
-20... +55
8
A2
01
BE 190-EN-MH
9616153
90W MH
172
0,44
5
1,5
0,98
85
-20... +55
8
A2
01
BE 1100-EN-MH
9616165
100W MH/HPS
172
0,49
5
1,5
0,98
85
-20... +55
8
A2
01
BE 1140-EN-MH
9616173
140W MH
172
0,68
5
1,5
0,98
85
-20... +55
8
A2
01
BE 1150-EN-MH
9616105
150W MH/HPS
172
0,73
5
1,5
0,98
85
-20... +55
8
A2
01
5RGEKſECVKQPU
~ Built-in ballast, protection index IP-20.
~ Suitable for street lighting applications.
~ Encapsulated for components protection.
~ No electrolytic capacitors: long life up to 80.000 hours.
~ Reduced own losses EEI=A2.
~ Stabilized lamp power.
~ Low frequency operation (172Hz).
~ Pulse time limited to 25 minutes, pulse-pause technology.
~ Permitted input voltage AC: 198-264V.
~ Conductor section: 0,5-2,5 mm2 .
~ Input transient, surge and strike protection device ITP is suitable for
this driver pag. 90 and www.elt.es\productos\pdf\701000000.pdf.
Características:
~ Equipos a incorporar, índice de protección IP-20.
~ Adecuadas para aplicaciones de alumbrado de exterior.
~ Encapsuladas para la protección de los componentes.
~ Sin condensadores electrolíticos: vida prolongada del equipo hasta
80.000 horas.
~ Reducidas pérdidas propias EEI=A2.
~ Potencia estabilizada en lámpara.
~ Operación en baja frecuencia (172Hz).
~ Tiempo de impulso limitado a 25 minutos, tecnología pulso-pausa.
~ Tensión permitida AC: 198-264V.
~ Sección del conductor: 0,5-2,5 mm2 .
~ Balasto electrónico compatible con el sistema de protección contra
rayos e impulsos en la entrada ITP pág. 90 y
www.elt.es\productos pdf\701000000.pdf.
2TQVGEVKQPU
~ Enhanced protection against surge pulses: 4Kv to ground, 6Kv
between phases.
~ With thermal protection.
~ Protected against rectifying effect and end-of-life effect.
~ Protected against short circuit in lamp.
Protecciones:
~ Protección reforzada contra impulsos de sobretensión en red: 4Kv
a tierra, 6Kv entre fases.
~ Protección térmica.
`2TQVGEEKÎPEQPVTCGHGEVQTGEVKſECFQT[ſPFGXKFC
~ Protección contra cortocircuito en lámpara.
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
No conectar
Red
Do not connect Mains
120
6
L-N
N
EN-61347-2-12 Safety / Seguridad
EN-61000-3-2 Harmonics / Armónicos
EN-55015 Interferences / Interferencias
EN-61547 EMC Immunity / Inmunidad CEM
www.elt.es
177
L
Lámpara
Lamp
Electronic ballasts with power control SMI for metal halide lamps
Encapsulated type
Balastos electrónicos con regulación de potencia SMI
para lámparas de halogenuros metálicos
Tipo encapsulado
38,3
154,4
144,6
78,5 93,4
Homologaciones
Índice
Approvals
Index
Unidades por caja
Units per box
Temp. funcionamiento
Operating temp.
Temp.máx. envolvente
Max.temp. at tc point
Factor de potencia
Power factor
Longitud máx. a lámp.
Ahorro de potencia
Max. cable length to lamp.
Energy saving
Tensión de encendido
Lámpara
Intensidad
Lamp
Ignition voltage
Modelo
Ref. No.
Current
Model
Frecuencia de función
SMI TECHNOLOGY - WITHOUT COMMAND WIRES / TECNOLOGÍA SMI - SIN LÍNEA DE MANDO
Operating frequency
BE-ENMH-SMI
220-240V
50-60Hz
Hz
A
Kv
%
m
NJ
tc °C
ta °C
BE 145-EN-MH-SMI
9616112
45W MH
172
0,23
5
30
1,5
0,98
85
-20...+55
8
A2
BE 150-EN-MH-SMI
9616122
50W MH/HPS
172
0,25
5
30
1,5
0,98
85
-20...+55
8
A2
BE 150-EN-MH-SMI2
9616126
50W MH/HPS
172
0,25
5
20-30
1,5
0,98
85
-20…+55
8
A2
BE 160-EN-MH-SMI
9616132
60W MH
172
0,30
5
40
1,5
0,98
85
-20...+55
8
A2
BE 170-EN-MH-SMI
9616142
70W MH/HPS
172
0,35
5
40
1,5
0,98
85
-20...+55
8
A2
BE 170-EN-MH-SMI2
9616148
70W MH/HPS
172
0,35
5
20-40
1,5
0,98
85
-20…+55
8
A2
BE 190-EN-MH-SMI
9616152
90W MH
172
0,44
5
40
1,5
0,98
85
-20...+55
8
A2
01
BE 1100-EN-MH-SMI
9616162
100W MH/HPS
172
0,49
5
40
1,5
0,98
85
-20...+55
8
A2
01
BE 1100-EN-MH-SMI2
9616169
100W MH/HPS
172
0,49
5
20-40
1,5
0,98
85
-20…+55
8
A2
BE 1140-EN-MH-SMI
9616172
140W MH
172
0,68
5
40
1,5
0,98
85
-20...+55
8
A2
BE 1150-EN-MH-SMI
9616102
150W MH/HPS
172
0,73
5
40
1,5
0,98
85
-20...+55
8
A2
BE 1150-EN-MH-SMI2
9616109
150W MH/HPS
172
0,73
5
20-40
1,5
0,98
85
-20…+55
8
A2
5RGEKſECVKQPU
~ Built-in ballast, protection rating IP-20.
~ Suitable for street lighting applications.
~ Encapsulated for components protection.
~ No electrolytic capacitors: long life up to 80.000 hours.
~ Reduced own losses EEI=A2.
~ Stabilized lamp power.
~ Reduction of the lamp power up to 20, 30 or 40% and up to 50% of
VJGNWOKPQWUƀWZ
~ The lamp is not dimmed until at least 15 minutes of operation.
~ Low frequency operation (172Hz).
~ Valid for lamps allowing dimming.
~ Pulse time limited to 25 minutes, pulse-pause technology.
~ Permitted input voltage AC: 198-264V.
~ Conductor section: 0,5-2,5 mm2 .
~ Input transient, surge and strike protection device ITP is suitable for
this driver pag. 90 and www.elt.es\productos\pdf\701000000.pdf.
EEI
01
01
01
01
-
01
01
-
Características:
~ Equipos a incorporar, índice de protección IP-20.
~ Adecuadas para aplicaciones de alumbrado de exterior.
~ Encapsuladas para la protección de los componentes.
~ Sin condensadores electrolíticos: vida prolongada del equipo hasta
80.000 horas.
~ Reducidas pérdidas propias EEI=A2.
~ Potencia estabilizada en lámpara.
~ Reducción de la potencia en lámpara de hasta el 20, 30 o 40% y
FGNƀWLQNWOKPQUQJCUVCGN
`0QUGTGFWEGNCRQVGPEKCGPN¶ORCTCJCUVCCNOGPQUOKPWVQUFG
funcionamiento.
~ Operación en baja frecuencia (172Hz).
~ Válidas para las lámparas de halogenuros metálicos que admitan
regulación.
`6KGORQFGKORWNUQNKOKVCFQCOKPWVQUVGEPQNQIÈCRWNUQRCWUC
~ Tensión permitida AC: 198-264V.
`5GEEKÎPFGNEQPFWEVQTOO2 .
~ Balasto electrónico compatible con el sistema de protección contra
rayos e impulsos en la entrada ITP pág. 90 y
www.elt.es\productos pdf\701000000.pdf.
120
No conectar
Red
Do not connect Mains
6
Lámpara
Lamp
L-N
EN-61347-2-12 Safety / Seguridad
EN-61000-3-2 Harmonics / Armónicos
EN-55015 Interferences / Interferencias
EN-61547 EMC Immunity / Inmunidad CEM
N
178
L
www.elt.es
Protections:
~ Enhanced protection against surge pulses: 4Kv to ground, 6Kv
between phases.
~ With thermal protection.
~ Protected against rectifying effect and end-of-life effect.
~ Protected against short circuit in lamp.
Protecciones:
~ Protección reforzada contra impulsos de sobretensión en red: 4Kv
a tierra, 6Kv entre fases.
~ Protección térmica.
`2TQVGEEKÎPEQPVTCGHGEVQTGEVKſECFQT[ſPFGXKFC
~ Protección contra cortocircuito en lámpara.
SMI and SMI2 technologies of astronomical response:
~ Without command wires.
~ Automatic changeover to low level during the central period of the
night.
~ Optimized saving time for any night length.
Tecnologías SMI y SMI2 de respuesta astronómica:
~ No necesita línea de mando.
~ Ajuste automático del paso a nivel reducido para la parte central de
la noche.
`'ſEKGPEKCQRVKOK\CFCRCTCEWCNSWKGTFWTCEKÎPFGNCPQEJG
SMI
Response en Helsinki
Comportamiento en Helsinki
16
18
20
22
24
2
4
6
Response en Madrid
Comportamiento en Madrid
8
10 h.
18
January
Enero
20
22
24
2
4
6
8
10 h.
8
10 h.
January
Enero
100%
W Lamp
60%
W Lamp
(1)
December
Diciembre
(1)
December
Diciembre
Mod. 9616112 - 9616122: 70%
SMI2
Response en Helsinki
Comportamiento en Helsinki
16
18
20
22
24
2
4
6
Response en Madrid
Comportamiento en Madrid
8
10 h.
18
January
Enero
20
22
24
2
4
6
January
Enero
100%
W Lamp
80%
W Lamp
60%
W Lamp
December
Diciembre
(1)
(1)
December
Diciembre
Mod.9616126: 70%
Detailed explanation of the operation page 239
'ZRNKECEKÎPFGVCNNCFCFGNHWPEKQPCOKGPVQR¶IKPC
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
'ODCNCLG[RGUQR¶I[YYYGNVGURTQFWEVQUGODCNCLGA'.6RFH
www.elt.es
179
Electronic ballasts with power control depending on main voltage
encapsulated type for high pressure sodium vapour lamps
Balastos electrónicos con regulación de potencia, dependiente de
tensión de alimentación tipo encapsulado para lámparas de vapor
de sodio alta presión
38,3
154,4
144,6
LAMP
POWER
100%
90%
78,5 93,4
80%
70%
60%
Homologaciones
Índice
Approvals
Index
Unidades por caja
Units per box
Temp. funcionamiento
Operating temp.
Temp.máx. envolvente
Max.temp. at tc point
Power factor
Factor de potencia
VSUPPLY
Longitud máx. a lámp.
Ahorro de potencia
Frecuencia
de función
230V
Max. cable length to lamp.
Lámpara
220V
Energy saving
Operating
frequency
Intensidad
Ref. No.
Modelo
Lamp
210V
Ignition voltage
Model
198V
Tensión de encendido
(V±2%)
Current
DBE-EN-HPS
220-240V
50-60Hz
Hz
A
Kv
%
m
NJ
tc °C
ta °C
DBE 150-EN-MH
9616124
50W MH/HPS
172
0,25
5
30
1,5
0,98
85
-20...+55
8
EEI
A2
01
DBE 170-EN-MH
9616146
70W MH/HPS
172
0,35
5
40
1,5
0,98
85
-20...+55
8
A2
01
DBE 1100-EN-MH
9616167
100W MH/HPS
172
0,49
5
40
1,5
0,98
85
-20...+55
8
A2
01
DBE 1150-EN-MH
9616107
150W MH/HPS
172
0,73
5
40
1,5
0,98
85
-20...+55
8
A2
01
5RGEKſECVKQPU
~ These electronic ballasts with power control are especially designed
for installations with step-down transformer dimming: the lamp
output is reduced as the mains voltage is decreased.
~ The lamp is not dimmable affter at least 15 minutes of operation.
~ Built-in ballast, protection index IP-20.
~ Suitable for street lighting applications.
~ Encapsulated for components protection.
~ No electrolytic capacitors: long life up to 80.000 hours.
~ Reduced own losses EEI=A2.
~ Low frequency operation (172Hz).
~ Pulse time limited to 25 minutes, pulse-pause technology.
~ Permitted input voltage AC: 198-264V.
~ Input transient, surge and strike protection device ITP is suitable for
this driver pag. 90 and www.elt.es\productos\pdf\701000000.pdf.
Características:
~ Balastos con regulación de potencia especialmente diseñados para
instalaciones con reductor en cabecera: atenúan la iluminación
cuando se reduce la tensión de alimentación.
~ No se reduce la potencia en lámpara hasta al menos 15 minutos de
funcionamiento.
~ Equipos a incorporar, índice de protección IP-20.
~ Adecuadas para aplicaciones de alumbrado de exterior.
~ Encapsuladas para la protección de los componentes.
~ Sin condensadores electrolíticos: vida prolongada del equipo hasta
80.000 horas.
~ Reducidas pérdidas propias EEI=A2.
~ Operación en baja frecuencia (172Hz).
~ Tiempo de impulso limitado a 25 minutos, tecnología pulso-pausa.
~ Tensión permitida AC: 198-264V.
~ Balasto electrónico compatible con el sistema de protección contra
rayos e impulsos en la entrada ITP pág. 90 y
www.elt.es\productos pdf\701000000.pdf.
2TQVGEVKQPU
~ Enhanced protection against surge pulses: 4KV to ground, 6KV
between phases.
~ With thermal protection.
~ Protected against rectifying effect and end-of-life effect.
~ Protected against short circuit in lamp.
Protecciones:
~ Protección reforzada contra impulsos de sobretensión en red:
4KV a tierra, 6KV entre fases.
~ Protección térmica.
`2TQVGEEKÎPEQPVTCGHGEVQTGEVKſECFQT[ſPFGXKFC
~ Protección contra cortocircuito en lámpara.
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
W
V
rms
No conectar
Red
Do not connect Mains
120
Lámpara
Lamp
6
L-N
N
EN-61347-2-12 Safety / Seguridad
EN-61000-3-2 Harmonics / Armónicos
EN-55015 Interferences / Interferencias
EN-61547 EMC Immunity / Inmunidad CEM
180
L
www.elt.es
Electronic ballasts with power control depending on main voltage
encapsulated type for metal halide lamps
Balastos electrónicos con regulación de potencia, dependiente de
tensión de alimentación tipo encapsulado para lámparas
de halogenuros metálicos
DBE-EN-MH
220-240V
50-60Hz
38,3
154,4
144,6
LAMP
POWER
100%
90%
80%
78,5 93,4
70%
60%
Homologaciones
Índice
Approvals
Index
Unidades por caja
Units per box
Temp. funcionamiento
Operating temp.
Temp.máx. envolvente
Max.temp. at tc point
Power factor
Factor de potencia
VSUPPLY
Longitud máx. a lámp.
Ahorro de potencia
230V
Max. cable length to lamp.
Frecuencia
de función
220V
Energy saving
Lámpara
210V
Tensión de encendido
Operating
frequency
Intensidad
Ref. No.
Modelo
Lamp
Current
Model
198V
Ignition voltage
(V±2%)
Hz
A
Kv
%
m
NJ
tc °C
ta °C
DBE 145-EN-MH
9616114
45W MH
172
0,23
5
30
1,5
0,98
85
-20... +55
8
EEI
A2
01
DBE 150-EN-MH
9616124
50W MH/HPS
172
0,25
5
30
1,5
0,98
85
-20... +55
8
A2
01
DBE 160-EN-MH
9616134
60W MH
172
0,30
5
40
1,5
0,98
85
-20... +55
8
A2
01
DBE 170-EN-MH
9616146
70W MH/HPS
172
0,35
5
40
1,5
0,98
85
-20... +55
8
A2
01
DBE 190-EN-MH
9616154
90W MH
172
0,44
5
40
1,5
0,98
85
-20... +55
8
A2
01
DBE 1100-EN-MH
9616167
100W MH/HPS
172
0,49
5
40
1,5
0,98
85
-20... +55
8
A2
01
DBE 1140-EN-MH
9616174
140W MH
172
0,68
5
40
1,5
0,98
85
-20... +55
8
A2
01
DBE 1150-EN-MH
9616107
150W MH/HPS
172
0,73
5
40
1,5
0,98
85
-20... +55
8
A2
01
5RGEKſECVKQPU
~ These electronic ballasts with power control are especially designed
for installations with step-down transformer dimming: the lamp
output is reduced as the mains voltage is decreased.
~ The lamp is not dimmable affter at least 15 minutes of operation.
~ Built-in ballast, protection index IP-20.
~ Suitable for street lighting applications.
~ Encapsulated for components protection.
~ No electrolytic capacitors: long life up to 80.000 hours.
~ Reduced own losses EEI=A2.
~ Low frequency operation (172Hz).
~ Pulse time limited to 25 minutes, pulse-pause technology.
~ Permitted input voltage AC: 198-264V.
~ Input transient, surge and strike protection device ITP is suitable for
this driver pag. 90 and www.elt.es\productos\pdf\701000000.pdf.
Características:
~ Balastos con regulación de potencia especialmente diseñados para
instalaciones con reductor en cabecera: atenúan la iluminación
cuando se reduce la tensión de alimentación.
~ No se reduce la potencia en lámpara hasta al menos 15 minutos de
funcionamiento.
~ Equipos a incorporar, índice de protección IP-20.
~ Adecuadas para aplicaciones de alumbrado de exterior.
~ Encapsuladas para la protección de los componentes.
~ Sin condensadores electrolíticos: vida prolongada del equipo hasta
80.000 horas.
~ Reducidas pérdidas propias EEI=A2.
~ Operación en baja frecuencia (172Hz).
~ Tiempo de impulso limitado a 25 minutos, tecnología pulso-pausa.
~ Tensión permitida AC: 198-264V.
~ Balasto electrónico compatible con el sistema de protección contra
rayos e impulsos en la entrada ITP pág. 90 y
www.elt.es\productos pdf\701000000.pdf.
2TQVGEVKQPU
~ Enhanced protection against surge pulses: 4Kv to ground, 6Kv
between phases.
~ With thermal protection.
~ Protected against rectifying effect and end-of-life effect.
~ Protected against short circuit in lamp.
Protecciones:
~ Protección reforzada contra impulsos de sobretensión en red: 4Kv a
tierra, 6Kv entre fases.
~ Protección térmica.
`2TQVGEEKÎPEQPVTCGHGEVQTGEVKſECFQT[ſPFGXKFC
~ Protección contra cortocircuito en lámpara.
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
W
V
rms
No conectar
Red
Do not connect Mains
120
6
L-N
N
EN-61347-2-12 Safety / Seguridad
EN-61000-3-2 Harmonics / Armónicos
EN-55015 Interferences / Interferencias
EN-61547 EMC Immunity / Inmunidad CEM
www.elt.es
181
L
Lámpara
Lamp
VMI
220V
50Hz
Ballasts for mercury vapour lamps
Reactancias para lámparas de vapor de mercurio
B
B
A
A
6,5
6,5
82
L1
L2
L1
L2
Format 1
Formato 1
Format 2
Formato 2
Lamp
Power
factor
Lámpara
Model
Modelo
ţV
Ref. No.
Power
Potencia
Current
Intensidad
W
A
K
Factor de
potencia
Format
&KOGPUKQPU
Index
Dimensiones
Índice
Formato
NJ
Approvals
Homologaciones
A
mm
B
mm
L1
mm
L2
mm
EEI
VMI 8/22-2
5112120
80
0,80
60
0,50
1
62
52
85
106
A3
01
VMI 12/22-3
5112300
125
1,15
65
0,55
1
62
52
85
106
A3
01
VMI 25/22-2
5112290
250
2,13
70
0,57
1
87
73
96
115
A2
01
VMI 40/22-2
5112150
400
3,25
65
0,60
1
87
73
116
135
A2
VMI 100/22-5
5112581
1000
7,50
70
0,60
2
105
87
209+10
231
A2
01
-
~ Ballasts for built-in use.
~ Vacuum impregnated with polyester resin.
~ Thermal class tw=130°C.
~ Available with 2,5 mm2, 4 mm2, and 10 mm2 screw push wire
connection for powers of up to 125W, between 250, 400 and
1000W respectively.
~ Further voltages and frequencies can be manufactured upon
request.
~ Reactancias a incorporar.
~ Impregnadas al vacío en resina de poliéster.
~ Clase térmica tw=130°C.
~ Con bornera de conexión por tornillo, de 2,5 mm2, 4 mm2 y
10 mm2 para las potencias hasta 125W, entre 250, 400 y 1000W
respectivamente.
~ Bajo demanda se pueden fabricar de otras tensiones y
frecuencias.
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
2TQFWEVUGNGEVKQPQPYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
%CRCEKVQTUFCVCRCICPFQPYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
Selección de producto en www.elt.es/productos/buscador_producto.html
Tabla cond. pág. 231 y www.elt.es/productos/buscador_producto.html
1
R
3
L
C
EN-61347-2-9
EN-60923
N
182
www.elt.es
Ballasts for mercury vapour lamps
Reactancias para lámparas de vapor de mercurio
B
VMI
230V
50Hz
B
A
A
6,5
6,5
82
L1
L2
L1
L2
Format 1
Formato 1
Format 2
Formato 2
Lamp
Power
factor
Lámpara
Model
Modelo
ţV
Ref. No.
Power
Potencia
Current
Intensidad
W
A
K
Factor de
potencia
Format
&KOGPUKQPU
Index
Dimensiones
Índice
Formato
Homologaciones
A
mm
NJ
Approvals
B
mm
L1
mm
L2
mm
EEI
VMI 5/23-2
5112550
50
0,61
55
0,41
1
62
52
85
106
A3
VMI 8/23-2
5112430
80
0,80
60
0,50
1
62
52
85
106
A3
01
VMI 12/23-3
5112400
125
1,15
65
0,52
1
62
52
85
106
A3
01
VMI 25/23-3
5112410
250
2,13
70
0,55
1
87
73
96
115
A2
01
VMI 40/23-3
5112424
400
3,25
65
0,57
1
87
73
116
135
A2
VMI 70/23-3
5112570
700
5,45
60
0,58
2
105
87
146+10
168
A2
-
VMI 100/23-4
5112580
1000
7,50
65
0,60
2
130
106,5
141+12
170
A2
-
-
01
~ Ballasts for built-in use.
~ Vacuum impregnated with polyester resin.
~ Thermal class tw=130°C.
~ Available with 2.5 mm2, 4 mm2, and 10 mm2 screw push wire
connection for powers of up to 125W, between 250 and 700W,
and 1000W respectively.
~ Further voltages and frequencies can be manufactured upon
request.
~ Reactancias a incorporar.
~ Impregnadas al vacío en resina de poliéster.
~ Clase térmica tw=130°C.
~ Con bornera de conexión por tornillo, de 2,5 mm2, 4 mm2 y
10 mm2 para las potencias hasta 125W, entre 250 y 700W y
1000W respectivamente.
~ Bajo demanda se pueden fabricar de otras tensiones y
frecuencias.
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
2TQFWEVUGNGEVKQPQPYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
%CRCEKVQTUFCVCRCICPFQPYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
Selección de producto en www.elt.es/productos/buscador_producto.html
Tabla cond. pág. 231 y www.elt.es/productos/buscador_producto.html
1
L
C
EN-61347-2-9
EN-60923
www.elt.es
N
183
R
3
VMI
240V
50Hz
Ballasts for mercury vapour lamps
Reactancias para lámparas de vapor de mercurio
B
B
A
A
6,5
6,5
82
L1
L2
L1
L2
Format 1
Formato 1
Format 2
Formato 2
Lamp
Power
factor
Lámpara
Model
Modelo
ţV
Ref. No.
Power
Potencia
Current
Intensidad
W
A
K
Factor de
potencia
Format
&KOGPUKQPU
Index
Dimensiones
Índice
Formato
Homologaciones
A
mm
NJ
Approvals
B
mm
L1
mm
L2
mm
EEI
VMI 5/24-2
5112530
50
0,61
55
0,40
1
62
52
85
106
A3
VMI 8/24-2
5112450
80
0,80
60
0,48
1
62
52
85
106
A3
01
VMI 12/24-3
5112440
125
1,15
70
0,50
1
62
52
85
106
A3
01
VMI 25/24-3
5112250
250
2,13
70
0,53
1
87
73
96
115
A2
01
VMI 40/24-2
5112260
400
3,25
70
0,54
1
87
73
116
135
A2
VMI 70/24-3
5112571
700
5,45
65
0,56
2
105
87
146+10
168
A2
-
VMI 100/24-4
5112342
1000
7,50
65
0,60
2
130
106,5
141+12
170
A2
-
01
~ Ballasts for built-in use.
~ Vacuum impregnated with polyester resin.
~ Thermal class tw=130°C.
~ Available with 2,5 mm2, 4 mm2, and 10 mm2 screw push wire
connection for powers of up to 125W, between 250 and 700W,
and 1000W respectively.
~ Further voltages and frequencies can be manufactured upon
request.
~ Reactancias a incorporar.
~ Impregnadas al vacío en resina de poliéster.
~ Clase térmica tw=130°C.
~ Con bornera de conexión por tornillo, de 2,5 mm2, 4 mm2 y
10 mm2 para las potencias hasta 125W, entre 250 y 700W y
1000W respectivamente.
~ Bajo demanda se pueden fabricar de otras tensiones y
frecuencias.
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
2TQFWEVUGNGEVKQPQPYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
%CRCEKVQTUFCVCRCICPFQPYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
Selección de producto en www.elt.es/productos/buscador_producto.html
Tabla cond. pág. 231 y www.elt.es/productos/buscador_producto.html
1
R
3
L
C
EN-61347-2-9
EN-60923
N
184
www.elt.es
Ballasts for mercury vapour lamps
Reactancias para lámparas de vapor de mercurio
B
VMI
220V
60Hz
B
A
A
6,5
6,5
82
L1
L2
L1
L2
Format 1
Formato 1
Format 2
Formato 2
Lamp
Lámpara
Model
Modelo
Power factor
ţV
Ref. No.
Factor de
potencia
Power
Potencia
Current
Intensidad
W
A
K
NJ
&KOGPUKQPU
Dimensiones
Format
Formato
A
mm
B
mm
L1
mm
L2
mm
106
VMI 5/22-2
5113520
50
0,61
50
0,42
1
62
52
85
VMI 8/22-2
5113530
80
0,80
60
0,50
1
62
52
85
106
VMI 12/22-3
5113770
125
1,15
65
0,60
1
62
52
85
106
VMI 25/22-3
5113780
250
2,13
70
0,60
1
87
73
96
115
VMI 40/22-2
5113670
400
3,25
70
0,60
1
87
73
116
135
VMI 70/22-3
5113990
700
5,45
60
0,61
2
105
87
146+10
168
VMI 100/22-4
5113980
1000
8
70
0,60
2
130
106,5
91+12
120
~ Ballasts for built-in use.
~ Vacuum impregnated with polyester resin.
~ Thermal class tw=130°C.
~ Available with 2,5 mm2, 4 mm2, and 10 mm2 screw push wire
connection for powers of up to 125W, between 250 and 700W,
and 1000W respectively.
~ Further voltages and frequencies can be manufactured upon
request.
~ Reactancias a incorporar.
~ Impregnadas al vacío en resina de poliéster.
~ Clase térmica tw=130°C.
~ Con bornera de conexión por tornillo, de 2,5 mm2, 4 mm2 y
10 mm2 para las potencias hasta 125W, entre 250 y 700W y
1000W respectivamente.
~ Bajo demanda se pueden fabricar de otras tensiones y
frecuencias.
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
2TQFWEVUGNGEVKQPQPYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
%CRCEKVQTUFCVCRCICPFQPYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
Selección de producto en www.elt.es/productos/buscador_producto.html
Tabla cond. pág. 231 y www.elt.es/productos/buscador_producto.html
1
L
C
EN-61347-2-9
EN-60923
www.elt.es
N
185
R
3
VMI-SC
220-230
-240V
50Hz
$CNNCUVUHQTOGTEWT[XCRQWTNCORU4GFWEGFUGEVKQP
Reactancias para lámparas de vapor de mercurio.
Sección reducida
53
66
6,5
15
Ref. No.
Model
Modelo
9KVJ
9KVJQWV
thermal
thermal
RTQVGEVKQP RTQVGEVKQP
Con
Sin
protección protección
térmica
térmica
L1
L2
6
Lamp
Voltage
frecuency
Tensión
frecuencia
Power
factor
Lámpara
ţV
Power
Potencia
Current
Intensidad
Factor de
potencia
&KOGPUKQPU
Index
Dimensiones
Índice
Approvals
Homologaciones
V/Hz
W
A
K
NJ
L1
L2
VMI 25/22-SC
-
5112682
220/50
250
2,13
75
0,57
114
135
EEI
A2
VMI 25/23-SC
5112681
5112680
230/50
250
2,13
75
0,55
114
135
A2
VMI 25/24-SC
-
5112683
240/50
250
2,13
80
0,53
114
135
A2
-
01
VMI 40/22-SC
-
5112202
220/50
400
3,25
75
0,58
149
170
A2
VMI 40/23-SC
5112203
5112200
230/50
400
3,25
75
0,56
149
170
A2
01
VMI 40/24-SC
-
5112201
240/50
400
3,25
80
0,54
149
170
A2
01
~ Ballasts for built-in use.
~ Compactc size. Small dimensions. Suitable to be used where a low
cross-section ballasts is required.
~ Coils with enamelled wires of 200°C thermal class.
~ Vacuum impregnated in polyester.
~ Thermal class tw = 130°C.
~ Connections:
~ Screw connection 2,5 mm2.
~ Push wire connection 1,5 mm2.
~ Further voltages and frequencies can be manufactured upon
request.
~ These ballasts are also available with thermal protector. In such
case add “P” at the end.
(E.g.: VMI 25/23-SC-P.)
~ Reactancias a incorporar.
~ Tamaño compacto. Dimensiones reducidas. Aptas para alojar en
espacios, proyectores, cajas y luminarias pequeñas.
~ Bobinadas con hilo esmaltado de clase térmica 200°C.
~ Impregnadas al vacío en resina de poliéster.
~ Clase térmica tw = 130°C.
~ Bornes:
~ Conexión tornillo 2,5 mm2.
~ Conexión rápida 1,5 mm2.
~ Bajo demanda se pueden fabricar para otras tensiones y
frecuencias.
~ Estas reactancias se fabrican con protección térmica. Para
UQNKEKVCTNQUCÌCFKTCNVKRQNCNGVTCő2ŒCNſPCN
(Ejem: VMI 25/23-SC-P)
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
2TQFWEVUGNGEVKQPQPYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
%CRCEKVQTUFCVCRCICPFQPYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
Selección de producto en www.elt.es/productos/buscador_producto.html
Tabla cond. pág. 231 y www.elt.es/productos/buscador_producto.html
1
R
3
L
C
EN-61347-2-9
EN-60923
N
186
www.elt.es
$CNNCUVUQH%NCUU++HQTOGTEWT[XCRQWTNCORU*KIJRQYGTHCEVQT+2
Reactancias para lámparas de vapor de mercurio
Clase II IP40. Alto factor de potencia
A
A1
6,5–1
B
L
L 2 TR
10
–10
300
L1 LT
83
98,5
A2
W
A
A
NJ
ta (°C)
Dimensiones
B
L 1 L T L 2 L TR
A/A 2 A 1
mm mm mm mm mm mm mm
Homologaciones
Índice
Power
Power
Current
Current
factor
Potencia Intensidad Intensidad Factor de
potencia
&KOGPUKQPU
Approvals
Línea
Index
Lámpara
Formato
Supply
Format
Modelo
Ref.
No.
Lamp
Temp. funcionamiento
Model
Formato 2 / Format 2
1RGTCVKPIVGOR
Formato 1 / Format 1
EEI
VMI 8/23-C2
5211510
80
0,80
0,44
0,90 + 0,05
70
1
69/72
56
62
171
183
-
-
A3
01
VMI 8/23-C2S
5211520
80
0,80
0,44
0,90 + 0,05
70
2
69/72
56
62
-
-
106
118
A3
01
VMI 12/23-C2
5211530
125
1,15
0,66
0,90 + 0,05
70
1
69/72
56
62
171
183
-
-
A3
01
VMI 12/23-C2S
5211540
125
1,15
0,66
0,90 + 0,05
70
2
69/72
56
62
-
-
106
118
A3
01
VMI 25/23-C2
5211550
250
2,13
1,30
0,90 + 0,05
70
1
92/97
76
83
155
172
-
-
A2
01
VMI 25/23-C2S
5211560
250
2,13
1,30
0,90 + 0,05
70
2
92/97
76
83
-
-
112
A2
01
VMI 40/23-C2
5211570
400
3,25
2,00
0,90 + 0,05
70
1
92/97
76
83
175
192
-
-
A2
01
VMI 40/23-C2S
5211580
400
3,25
2,00
0,90 + 0,05
70
2
92/97
76
83
-
-
116
131
A2
01
96
~ Class II IP40 equipment comprising of ballast and power factor
correction capacitor.
~ Ballasts vacuum impregnated with polyester resin and
encapsulated in polyurethane resin.
~ Thermal class tw=130°C.
~ Class II thermoplastic material casing.
~ With Class II anti-traction connector.
~ Further voltages and frequencies can be manufactured upon
request.
~ Equipos Clase II IP40 que incluyen reactancia y condensador
de corrección de f. de p.
~ Reactancias impregnadas al vacío en resina de poliéster y
encapsuladas en resina de poliuretano.
~ Clase térmica tw=130°C.
~ Envolvente de material termoplástico de Clase II.
~ Con conector antitracción de Clase II.
~ Bajo demanda se pueden fabricar de otras tensiones y
frecuencias.
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
~
EN-61347-2-9
EN-60923
www.elt.es
L
187
N
Lamp
VMI-C2-C2S
230V
50Hz
VME-C2
230V
50Hz
'PECRUWNCVGFDCNNCUVUQHENCUU++HQTOGTEWT[XCRQWTNCORU
*KIJRQYGTHCEVQT+2
Reactancias encapsuladas para lámparas de vapor de mercurio.
Clase II IP54. Alto factor de potencia
A
A1
6,5 ±1
B
10
L1 LT
A2
525
Model
Modelo
Ref.
No.
Lamp
Supply
Lámpara
Línea
1RGTCVKPI
temp.
Temp.
Power
funcionamiento
Power
Current
Current
factor
Potencia Intensidad Intensidad Factor de
potencia
W
A
A
ta (°C)
NJ
&KOGPUKQPU
Index
Dimensiones
Índice
Approvals
Homologaciones
B
L1 LT
A/A 2 A 1
mm mm mm mm mm
EEI
VME 8/23-C2-AF
5210290
80
0,80
0,44
0,90 + 0,05
60
69/72
56
62
171
183
A3
01
VME 12/23-C2-AF
5210300
125
1,15
0,66
0,90 + 0,05
50
69/72
56
62
171
183
A3
01
VME 25/23-C2-AF
5210270
250
2,13
1,27
0,90 + 0,05
50
92/97
76
83
155
172
A2
01
VME 40/23-C2-AF
5210280
400
3,25
2,00
0,90 + 0,05
50
92/97
76
83
175
192
A2
01
~ Class II IP54 equipment for outdoor use comprising of ballast
and power factor correction capacitor.
~ Ballasts vacuum impregnated with polyester resin and
encapsulated in polyurethane resin.
~ Thermal class tw=130°C.
~ Class II thermoplastic material casing.
~ Connection with double insulated cables, hose type.
~ Installed with wires downwards presenting IP54 protection index.
~ Further voltages and frequencies can be manufactured upon
request.
~ Equipos Clase II IP54 para intemperie que incorporan reactancia
y condensador de corrección del f. de p. Uso exterior.
~ Reactancias impregnadas al vacío en resina de poliéster y
encapsuladas en resina de poliuretano.
~ Clase térmica tw=130°C.
~ Envolvente de material termoplástico de Clase II.
~ Con conexiones por cables de doble aislamiento, tipo manguera.
~ Colocados con los cables hacia abajo presentan un índice de
protección IP54.
~ Bajo demanda se pueden fabricar de otras tensiones y
frecuencias.
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
L
~
EN-61347-2-9
EN-60923
N
188
NEGRO
Black
MARRON
Brown
AZUL
Blue
www.elt.es
$CNNCUVUDK2QYGTU[UVGOHQTOGTEWT[
vapour lamps
Reactancias para lámparas de Vapor de Mercurio
Doble Nivel de Potencia
B
L2
L1
6
51
VMI-RME
230V
50Hz
B
L1
5
L2
6
41
5
6,5
6
A
86
80-125W
250-400W
NJ
A
B
L1 L2
mm mm mm mm
nº
Homologaciones
K
Índice
W
Approvals
W
Index
A
Esquema conexión
A
/CZKOWO Reduced
level
level
Nivel
Nivel
máximo
reducido
9KTKPIFKCITCO
W
Power
Potencia
Dimensiones
ţV
Current
Intensidad
&KOGPUKQPU
Línea / Potencia
Power factor
Lámpara
Reduced level
Nivel reducido
Modelo
Ref.
No.
Supply / Power
/CZKOWONGXGN
Nivel máximo
Model
Lamp
Factor de potencia
WITH COMMAND WIRES / CON LÍNEA DE MANDO
EEI
VMI 8/23-2P-RME-A
5114500
80
0,80
0,55
92
55
60
0,50
62
78
85
158
1
A3
01
VMI 12/23-2P-RME-A
5114510
125
1,15
0,72
139
84
60
0,55
62
78
105
178
1
A3
01
VMI 25/23-2P-RME-A
5114520
250
2,13
1,25
269
155
70
0,55
87
89
96
156
1
A2
01
VMI 40/23-2P-RME-A
5114530
400
3,25
2,00
426
250
70
0,58
87
89
116
176
1
A2
01
WITHOUT COMMAND WIRES (with timer) / SIN LÍNEA DE MANDO -SM- (temporizadas)
VMI 8/23-RME-SM
5114501
80
0,80
0,55
92
55
60
0,50
62
78
85
158
2
A3
01
VMI 12/23-2P-RME-SM
5114511
125
1,15
0,72
139
84
60
0,55
62
78
105
178
2
A3
01
VMI 25/23-2P-RME-SM
5114521
250
2,13
1,25
269
155
70
0,55
87
89
96
156
2
A2
01
VMI 40/23-2P-RME-SM
5114531
400
3,25
2,00
426
250
70
0,58
87
89
116
176
2
A2
01
~ The 100% of the lamp power is obtained by applying the control
voltage accross command line. Should you need the oppossite
sequence please request “-C” or “.C” type instead of “-A” type.
~ Equipment comprising of a double level ballast and relay to
switch the power level. For built-in use.
~ Vacuum impregnated with polyester resin.
~ Thermal class tw=130°C.
~ Available with 2,5 mm2 screw connection.
~ The models without control line (SM) are manufactured with a
ſZGFVKOKPIQHJTUOKPUFWTKPIYJKEJVJGNCORKUCV
maximum level and after which, the lamp changes to a reduced
level.
~ Further voltages and frequencies or other timings can be
manufactured upon request.
~ Equipos con el 100% de la potencia en lámpara con tensión en
el mando. Si se desea lo contrario, sustituir en la denominación
“–A” por “–C”.
~ Equipos a incorporar con reactancia de doble nivel y relé para
conmutación del nivel de potencia.
~ Reactancias impregnadas al vacío en resina de poliéster.
~ Clase térmica tw=130°C.
~ Con bornera de conexión por tornillo, de 2,5 mm2.
~ Los modelos sin línea de mando (SM) se fabrican con una
VGORQTK\CEKÎPſLCFGJŏFWTCPVGNCUEWCNGUNCN¶ORCTC
permanece a nivel máximo; pasado este tiempo, cambia a nivel
reducido.
~ Bajo demanda se pueden fabricar de otras tensiones y
frecuencias o de otras temporizaciones.
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
1
C
C
~
EN-61347-2-9
EN-60923
www.elt.es
2
Lamp
189
M ando
N
Command
L
Lamp
C
~
N
L
$CNNCUVUDKRQYGTU[UVGOHQTOGTEWT[XCRQWTNCORU
Class II IP54
Reactancias para lámparas de vapor de mercurio
Clase II doble nivel de potencia IP54
–16,5
A
A1
B
10
L1 LT
A2
250
W
W
ta (°C)
NJ
B
L1 LT
A/A 2 A 1
mm mm mm mm mm
Índice
A
Index
A
Esquema conexión
W
9KTKPIFKCITCO
Reduced
level
Nivel
reducido
Dimensiones
/CZKOWO
level
Nivel
máximo
Power
Potencia
&KOGPUKQPU
Factor de potencia
Current
Intensidad
Power factor
Modelo
Ref.
No.
Reduced level
Nivel reducido
Model
1RGTCVKPIVGOR
Supply
Power
Línea
Potencia
Lamp
Lámpara
Temp. funcionamiento
WITH COMMAND WIRES / CON LÍNEA DE MANDO
/CZKOWONGXGN
Nivel máximo
nº
EEI
VME 8/23-2P-C2-AF
5218140
80
0,80
0,55
92
55
60
0,90
69/72
56
62
171
183
1
A3
VME 12/23-2P-C2-AF
5218150
125
1,15
0,72
139
84
50
0,90
69/72
56
62
171
183
1
A3
VME 25/23-2P-C2-AF
5218160
250
2,13
1,25
269
155
50
0,95
92/97
76
83
155
172
1
A2
VME 40/23-2P-C2-AF
5218170
400
3,25
2,00
426
250
50
0,95
92/97
76
83
175
192
1
A2
A3
WITHOUT COMMAND WIRES (with timer) / SIN LÍNEA DE MANDO -SM- (temporizadas)
VME 8/23-2P-C2-AF-SM
5218190
80
0,80
0,55
92
55
60
0,90
69/72
56
62
171
183
2
VME 12/23-2P-C2-AF-SM
5218180
125
1,15
0,72
139
84
40
0,95
92/97
76
83
155
172
2
A3
VME 25/23-2P-C2-AF-SM
5218161
250
2,13
1,25
269
155
50
0,95
92/97
76
83
155
172
2
A2
VME 40/23-2P-C2-AF-SM
5218171
400
3,25
2,00
426
250
50
0,95
92/97
76
83
175
192
2
A2
~ IP54 equipment for outdoor use, comprising of a double
level ballast, relay to switch the power level and a power factor
correction capacitor.
~ The 100% of the lamp power is obtained by applying the control
voltage accross command line.
~ Ballasts vacuum impregnated with polyester resin and
encapsulated in polyurethane resin.
~ Thermal class tw=130°C.
~ Class II thermoplastic material casing.
~ Connection with double insulated cables, hose type.
~ Installed with wires downwards presenting IP54 protection index.
~ The models without control line (SM) are manufactured with a
ſZGFVKOKPIQHJTUOKPUFWTKPIYJKEJVJGNCORKUCV
maximum level and after which, the lamp changes to a reduced
level.
~ Further voltages and frequencies, other timings or with a Class II
antitraction connector can be manufactured upon request.
~ Equipos IP54 para uso exterior. Incorporan reactancia
de doble nivel, relé para conmutación del nivel de potencia y
condensador de corrección del f. de p.
~ Equipos con el 100% de la potencia en lámpara con tensión en
el mando.
~ Reactancias impregnadas al vacío en resina de poliéster y
encapsuladas en resina de poliuretano.
~ Clase térmica tw=130°C.
~ Envolvente de material termoplástico de Clase II.
~ Con conexiones por cables de doble aislamiento, tipo maguera.
~ Colocadas con los cables hacia abajo presentan un índice de
protección IP54.
~ Los modelos sin línea de mando (SM) se fabrican con una
VGORQTK\CEKÎPſLCFGJŏFWTCPVGNCUEWCNGUNCN¶ORCTC
permanece a nivel máximo; pasado este tiempo, cambia a nivel
reducido.
~ Bajo demanda se pueden fabricar de otras tensiones y
frecuencias, de otras temporizaciones o con conector
antitracción de Clase II y uso interior.
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
1
2
MANDO
Control
MARRÓN
Brown
EN-61347-2-9
EN-60923
L
190
L
AZUL
Blue
NEGRO
Black
VME-2P-C2
230V
50Hz
~
N
~
N
NEGRO
Black
MARRON
Brown
AZUL
Blue
www.elt.es
Ballasts for high pressure sodium vapour lamps
Reactancias para lámparas de vapor de sodio a alta presión
B
VSI-E
220V
50Hz
B
A
A
6,5
6,5
82
L1
L2
L1
L2
Format 2
Formato 2
Power
factor
Lámpara
ţV
Model
Modelo
VSI 5/22-2
With
thermal
protection
Con
protección
térmica
Without
thermal
protection
Sin
protección
térmica
Power
Potencia
Current
Intensidad
W
A
K
Wiring
diagram
Dimensions
Format
Factor
de
potencia Formato
Dimensiones
A
mm
NJ
B
mm
L1
mm
Index
Esquema Índice
conexión
L2
mm
nº
Homologaciones
Lamp
Ref. No.
Approvals
Format 1
Formato1
EEI
-
6112410
50
0,76
50
0,35
1
62
52
85
106
1-3
A3
VSI 7/22-3T-E
6112704
6112700
70
1,00
70
0,38
1
62
52
85
106
1-2-3
A3
01
VSI 10/22-2
6112145
6112140
100
1,20
70
0,44
1
62
52
105
126
2-3
A3
01
VSI 15/22-3T-E
6112315
6112330
150
1,80
75
0,40
1
87
73
96
115
2-3
A3
01
VSI 25/22-3T-E
6112653
6112650
250
3,00
65
0,40
1
87
73
116
135
2-3
A3
01
VSI 40/22-3T-E
6112666
6112660
400
4,45
75
0,45
1
87
73
146
165
2-3
A2
VSI 40/23-3T-E
-
6112661
400
4,60
70
0,43
1
87
73
146
165
2-3
A2
VSI 60/3T-E
6112601
6112406
600
6,10
65
0,47
2
105
87
146+10
168
2-3
A2
01
VSI 100/3T-E
-
6112293
1000
10,30
75
0,47
2
105
87
209+10
231
2-3
A2
01
01
-
~ Ballasts for built-in use.
~ Vacuum impregnated with polyester resin.
~ Thermal class tw=130°C.
~ Available with 2.5 mm2, 4 mm2, and 10 mm2 screw connection
for powers of up to 100W, between 250 and 600W, and 1000W
respectively.
~ Also manufactured with incorporated thermal protection.
To request this add the letter -P to the end of each type
(e.g. VSI 25/22-3T-E-P).
~ Further voltages and frequencies can be manufactured upon
request.
~ Reactancias a incorporar.
~ Impregnadas al vacío en resina de poliéster.
~ Clase térmica tw=130°C.
~ Con bornera de conexión por tornillo, de 2,5 mm2, 4 mm2 y
10 mm2 para las potencias hasta 100W, entre 250 y 600W y
1000W respectivamente.
~ También se fabrican con protección térmica incorporada.
2CTCUQNKEKVCTNCUCÌCFKTNCNGVTCŌ2CNſPCNFGECFCVKRQ
(Ej.: VSI 25/22-3T-E-P).
~ Bajo demanda se pueden fabricar de otras tensiones y
frecuencias.
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
2TQFWEVUGNGEVKQPQPYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
+IPKVQTUFCVCRCICPFQPYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
%CRCEKVQTFCVCRCICPFQPYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
Selección de producto en www.elt.es/productos/buscador_producto.html
Tabla arrancadores pág. 222 y www.elt.es/productos/buscador_producto.html
Tabla cond. pág. 231 y www.elt.es/productos/buscador_producto.html
1
1
2
R
3
L
L
R
3
2
C
C
EN-61347-2-9
EN-60923
www.elt.es
Negro
(Black)
Azul
(Blue)
N
N
191
3
1
3
Rojo
(Red)
R
1
L
2
RL N
C
AVS 100...
N
A
AVS-400-D
AVS-1000
Ballasts for high pressure sodium vapour lamps
Reactancias para lámparas de vapor de sodio a alta presión
B
B
A
A
6,5
6,5
82
L1
L2
L1
L2
Format 2
Formato 2
Lamp
Ref. No.
Power
factor
Lámpara
ţV
Model
Modelo
With
thermal
protection
Con
protección
térmica
Without
thermal
protection
Sin
protección
térmica
Power
Potencia
Current
Intensidad
W
A
K
Wiring
diagram
Dimensions
Format
Factor
de
potencia Formato
Dimensiones
A
mm
NJ
B
mm
L1
mm
Index
Esquema Índice
conexión
L2
mm
nº
Homologaciones
Format 1
Formato1
Approvals
VSI-D
230V
50Hz
EEI
VSI 5/22-3T-D
6112422
6112421
50
0,76
60
0,34
1
62
52
85
106
1-2-3
A3
01
VSI 7/22-3T-D
6112044
6112040
70
1,00
70
0,37
1
62
52
85
106
1-2-3
A3
01
01
VSI 10/22-3T-B
6112182
6112180
100
1,20
70
0,42
1
62
52
105
126
2-3
A3
VSI 15/22-3T-D
6112470
6112340
150
1,80
75
0,40
1
87
73
96
115
2-3
A3
01
VSI 25/22-3T-D
6112460
6112350
250
3,00
65
0,40
1
87
73
116
135
2-3
A3
01
VSI 40/22-3T-D
6112363
6112360
400
4,45
80
0,42
1
87
73
146
165
2-3
A2
01
VSI 40/23-3T-D
6112366
6112361
400
4,60
70
0,42
1
87
73
146
165
2-3
A2
01
VSI 60/3T-D
6112402
6112401
600
6,10
70
0,45
2
105
87
146+10
168
2-3
A2
01
VSI 100/3T-D
-
6112291
1000
10,30
75
0,47
2
105
87
209+10
231
2-3
A2
01
~ Ballasts for built-in use.
~ Vacuum impregnated with polyester resin.
~ Thermal class tw=130°C.
~ Available with 2,5 mm2, 4 mm2, and 10 mm2 screw connection
for powers of up to 100W, between 250 and 600W, and 1000W
respectively.
~ Also manufactured with incorporated thermal protection.
To request this add the letter -P to the end of each type
(e.g. VSI 25/22-3T-D-P).
~ Further voltages and frequencies can be manufactured upon
request.
~ Reactancias a incorporar.
~ Impregnadas al vacío en resina de poliéster
~ Clase térmica tw=130°C.
~ Con bornera de conexión por tornillo, de 2,5 mm2, 4 mm2 y
10 mm2 para las potencias hasta 100W, entre 250 y 600W y
1000W respectivamente.
~ También se fabrican con protección térmica incorporada.
2CTCUQNKEKVCTNCUCÌCFKTNCNGVTCŌ2CNſPCNFGECFCVKRQ
(Ej.: VSI 25/22-3T-D-P).
~ Bajo demanda se pueden fabricar de otras tensiones y
frecuencias.
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
2TQFWEVUGNGEVKQPQPYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
+IPKVQTUFCVCRCICPFQPYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
%CRCEKVQTFCVCRCICPFQPYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
Selección de producto en www.elt.es/productos/buscador_producto.html
Tabla arrancadores pág. 222 y www.elt.es/productos/buscador_producto.html
Tabla cond. pág. 231 y www.elt.es/productos/buscador_producto.html
1
1
2
R
3
L
L
R
3
2
C
C
EN-61347-2-9
EN-60923
Negro
(Black)
Azul
(Blue)
N
N
192
3
1
3
Rojo
(Red)
R
1
L
2
RL N
C
AVS 100...
N
A
AVS-400-D
AVS-1000
www.elt.es
Ballasts for high pressure sodium vapour lamps
Reactancias para lámparas de vapor de sodio a alta presión
B
VSI-G
240V
50Hz
B
A
A
6,5
6,5
82
L1
L2
L1
L2
Format 2
Formato 2
Power
factor
Lámpara
ţV
Model
Modelo
With
thermal
protection
Con
protección
térmica
Without
thermal
protection
Sin
protección
térmica
Power
Potencia
Current
Intensidad
W
A
K
Wiring
diagram
Dimensions
Format
Factor
de
potencia Formato
Dimensiones
A
mm
NJ
B
mm
L1
mm
Index
Esquema Índice
conexión
L2
mm
nº
Homologaciones
Lamp
Ref. No.
Approvals
Format 1
Formato1
EEI
VSI 7/22-3T-G
6111560
6111510
70
1,00
70
0,37
1
62
52
85
106
1-2-3
A3
01
VSI 10/22-3T-G
6111525
6111520
100
1,20
70
0,42
1
62
52
105
126
2-3
A3
01
01
VSI 15/22-3T-G
6111570
6111530
150
1,80
75
0,40
1
87
73
96
115
2-3
A3
VSI 25/22-3T-G
6111541
6111540
250
3,00
65
0,40
1
87
73
116
135
2-3
A3
01
VSI 40/22-3T-G
6111552
6111550
400
4,45
80
0,42
1
87
73
146
165
2-3
A2
01
VSI 40/23-3T-G
6112365
6111551
400
4,6
75
0,41
1
87
73
146
165
2-3
A2
01
VSI 60/3T-G
6112407
6112403
600
6,10
70
0,44
2
105
87
146+10
168
2-3
A2
01
VSI 100/3T-G
-
6112292
1000
10,30
80
0,45
2
105
87
209+10
231
2-3
A2
01
~ Ballasts for built-in use.
~ Vacuum impregnated with polyester resin.
~ Thermal class tw=130°C.
~ Available with 2,5 mm2, 4 mm2, and 10 mm2 screw connection
for powers of up to 100W, between 250 and 600W, and 1000W
respectively.
~ Also manufactured with incorporated thermal protection.
To request this add the letter -P to the end of each type
(e.g. VSI 25/22-3T-G-P).
~ Further voltages and frequencies can be manufactured upon
request.
~ Reactancias a incorporar.
~ Impregnadas al vacío en resina de poliéster.
~ Clase térmica tw=130°C.
~ Con bornera de conexión por tornillo, de 2,5 mm2, 4 mm2 y
10 mm2 para las potencias hasta 100W, entre 250 y 600W y
1000W respectivamente.
~ También se fabrican con protección térmica incorporada.
2CTCUQNKEKVCTNCUCÌCFKTNCNGVTCŌ2CNſPCNFGECFCVKRQ
(Ej.: VSI 25/22-3T-G-P).
~ Bajo demanda se pueden fabricar de otras tensiones y
frecuencias.
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
2TQFWEVUGNGEVKQPQPYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
+IPKVQTUFCVCRCICPFQPYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
%CRCEKVQTFCVCRCICPFQPYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
Selección de producto en www.elt.es/productos/buscador_producto.html
Tabla arrancadores pág. 222 y www.elt.es/productos/buscador_producto.html
Tabla cond. pág. 231 y www.elt.es/productos/buscador_producto.html
1
1
2
R
3
L
L
R
3
2
C
C
EN-61347-2-9
EN-60923
www.elt.es
Negro
(Black)
Azul
(Blue)
N
N
193
3
1
3
Rojo
(Red)
R
1
L
2
RL N
C
AVS 100...
N
A
AVS-400-D
AVS-1000
VSI-E6
220V
60Hz
Ballasts for high pressure sodium vapour lamps
Reactancias para lámparas de vapor de sodio a alta presión
B
B
A
A
6,5
6,5
82
L1
L2
L1
L2
Format 2
Formato 2
Format 1
Formato1
Lamp
Power
factor
Lámpara
Model
Modelo
ţV
Ref. No.
Power
Potencia
Current
Intensidad
W
A
Format
Factor de
potencia
K
Wiring
diagram
Dimensions
Dimensiones
Esquema
conexión
Formato
A
mm
NJ
B
mm
L1
mm
L2
mm
nº
VSI 5/22-3T-E6
6113873
50
0,76
50
0,35
1
62
52
85
106
1-2-3
VSI 7/22-3T-E6
6113920
70
1,00
65
0,38
1
62
52
85
106
1-2-3
VSI 10/22-2
6113860
100
1,20
70
0,44
1
62
52
105
126
2-3
VSI 15/22-3T-E6
6113590
150
1,80
70
0,42
1
87
73
96
115
2-3
VSI 25/22-3T-E6
6113601
250
3,00
65
0,42
1
87
73
116
135
2-3
VSI 40/22-3T-E6
6113610
400
4,45
70
0,45
1
87
73
146
165
2-3
VSI 60/3T-E6
6113979
600
6,10
70
0,47
2
105
87
146+10
168
2-3
VSI 100/3T-E6
6113888
1000
10,30
75
0,49
2
105
87
209+10
231
2-3
~ Ballasts for built-in use.
~ Vacuum impregnated with polyester resin
~ Thermal class tw=130°C.
~ Available with 2,5 mm2, 4 mm2, and 10 mm2 screw connection
for powers of up to 100W, between 250 and 600W, and 1000W
respectively.
~ Also manufactured with incorporated thermal protection.
To request this add the letter -P to the end of each type
(e.g. VSI 25/22 - 3T -E6-P).
~ Further voltages and frequencies can be manufactured upon
request.
~ Reactancias a incorporar.
~ Impregnadas al vacío en resina de poliéster
~ Clase térmica tw=130°C.
~ Con bornera de conexión por tornillo, de 2,5 mm2, 4 mm2 y
10 mm2 para las potencias hasta 100W, entre 250 y 600W y
1000W respectivamente.
~ También se fabrican con protección térmica incorporada.
2CTCUQNKEKVCTNCUCÌCFKTNCNGVTCŌ2CNſPCNFGECFCVKRQ
(Ej.: VSI 25/22-3T-E6-P).
~ Bajo demanda se pueden fabricar de otras tensiones y
frecuencias.
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
2TQFWEVUGNGEVKQPQPYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
+IPKVQTUFCVCRCICPFQPYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
%CRCEKVQTFCVCRCICPFQPYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
Selección de producto en www.elt.es/productos/buscador_producto.html
Tabla arrancadores pág. 222 y www.elt.es/productos/buscador_producto.html
Tabla cond. pág. 231 y www.elt.es/productos/buscador_producto.html
1
1
2
R
3
L
L
R
3
2
C
C
EN-61347-2-9
EN-60923
Negro
(Black)
Azul
(Blue)
N
N
194
3
1
3
Rojo
(Red)
R
1
L
2
RL N
C
AVS 100...
N
A
AVS-400-D
AVS-1000
www.elt.es
$CNNCUVUHQTJKIJRTGUUWTGUQFKWOXCRQWTNCORU
4GFWEGFUGEVKQP
Reactancias para lámparas de vapor de sodio a alta presión
Sección reducida
VSI-SC
220-230-240V
50-60Hz
53
66
6,5
L1
L2
15
Ref. No.
Model
Modelo
9KVJ
9KVJQWV
thermal
thermal
RTQVGEVKQP RTQVGEVKQP
Con
Sin
protección protección
térmica
térmica
6
Lamp
Voltage
frecuency
Tensión
frecuencia
Power
factor
Lámpara
ţV
Factor
de
potencia
Power
Current
Potencia Intensidad
9KTKPI
&KOGPUKQPU FKCITCO
Index
Approvals
Dimensiones Esquema Índice
conexión
Homologaciones
V/Hz
W
A
K
NJ
L1
mm
L2
mm
nº
EEI
VSI 15/3TE-SC
6112501
6112500
220/50
150
1,80
70
0,42
114
135
1-2
A3
01
VSI 15/3TD-SC
6112490
6112491
230/50
150
1,80
70
0,40
114
135
1-2
A3
01
VSI 15/3TG-SC
6112505
6112504
240/50
150
1,80
70
0,39
114
135
1-2
A3
01
VSI 15/3TE6-SC
6113522
6113521
220/60
150
1,80
70
0,42
114
135
1-2
-
01
VSI 25/3TE-SC
-
6112216
220/50
250
3,00
75
0,42
149
170
1-2
A3
01
VSI 25/3TD-SC
-
6112215
230/50
250
3,00
75
0,40
149
170
1-2
A3
01
VSI 25/3TG-SC
-
6112217
240/50
250
3,00
80
0,39
149
170
1-2
A3
01
VSI 25/3TE6-SC
-
6113691
220/60
250
3,00
75
0,42
149
170
1-2
-
01
~ Ballasts for built-in use.
~ Compactc size. Small dimensions. Suitable to be used where a low
cross-section ballasts is required.
~ Vacuum impregnated in polyester resin.
~ Thermal class tw = 130°C.
~ Connections:
~ Screw connection 2,5 mm2.
~ Push wire connection 1,5 mm2.
~ Further voltages and frequencies can be manufactured upon
request.
~ These ballasts are also available with thermal protector. In such
case add “P” at the end.
(e.g.: VSI 15/3TD-SC-P.)
~ Reactancias a incorporar.
~ Tamaño compacto. Dimensiones reducidas, Aptas para alojar en
espacios, proyectores, cajas y luminarias pequeñas.
~ Impregnadas al vacío en resina de poliéster.
~ Clase térmica tw = 130°C.
~ Bornes:
~ Conexión tornillo 2,5 mm2.
~ Conexión rápida 1,5 mm2.
~ Bajo demanda se pueden fabricar para otras tensiones y
frecuencias.
~ Estas reactancias se fabrican con protección térmica. Para
UQNKEKVCTNQUCÌCFKTCNVKRQNCNGVTCő2ŒCNſPCNFGECFCVKRQ
(Ejem: VSI 15/3TD-SC-P)
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
2TQFWEVUGNGEVKQPQPYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
+IPKVQTUFCVCRCICPFQPYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
%CRCEKVQTFCVCRCICPFQPYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
Selección de producto en www.elt.es/productos/buscador_producto.html
Tabla arrancadores pág. 222 y www.elt.es/productos/buscador_producto.html
Tabla cond. pág. 231 y www.elt.es/productos/buscador_producto.html
1
R
3
2
L
1
3
L
2
2
R LN
EN-61347-2-9
EN-60923
www.elt.es
N
C
A
C
AVS - 400...
195
R
Negro
(Black)
Azul
(Blue)
N
1
Rojo
(Red)
AVS 100-DP
VSE
220-230V
50Hz
Encapsulated ballasts for high pressure sodium vapour lamps
Reactancias encapsuladas para lámparas de vapor
de sodio a alta presión
B
A
8
A
B
L2 L1
L2 L1
10
6,5
5,5
Formato 2
Formato 2
Formato 1
Formato 1
220V
Lamp
Model
Modelo
Power
factor
Lámpara
Ref. No.
ţV
Power
Potencia
Current
Intensidad
W
A
Format
Factor de
potencia
K
Wiring
diagram
Dimensions
Dimensiones
Formato
A
mm
NJ
B
mm
Esquema
conexión
Índice
nº
EEI
L2
mm
L1
mm
Index
VSE 5/22-EA
6110190
50
0,76
60
0,35
1
70
60,3
112
132
1-3
A3
VSE 7/22-3T-E
6110330
70
1,00
70
0,38
1
70
60,3
112
132
1-2-3
A3
VSE 10/22-EA
6110170
100
1,20
70
0,44
2
70
60,3
106
118
2-3
A3
VSE 15/22-3T-E
6110360
150
1,80
70
0,40
2
92
83
96
112
2-3
A3
VSE 25/22-3T-E
6110350
250
3,00
70
0,40
2
92
83
116
132
2-3
A3
VSE 40/22-3T-E
6110370
400
4,45
70
0,43
2
92
83
146
162
2-3
A2
-
600
6,10
70
0,47
2
112
102
143
161
2-3
A2
VSE 5/22-3T-D
6110193
50
0,76
70
0,34
1
70
60,3
112
132
1-2-3
A3
VSE 7/22-3T-D
6110340
70
1,00
70
0,37
1
70
60,3
112
132
1-2-3
A3
VSE 10/22-3T-B
6110173
100
1,20
70
0,42
2
70
60,3
106
118
2-3
A3
VSE 60/3T-E
230V
VSE 15/22-3T-D
6110390
150
1,80
70
0,40
2
92
83
96
112
2-3
A3
VSE 25/22-3T-D
6110400
250
3,00
75
0,40
2
92
83
116
132
2-3
A3
VSE 40/22-3T-D
6110410
400
4,45
75
0,40
2
92
83
146
162
2-3
A2
-
600
6,10
75
0,45
2
112
102
143
161
2-3
A2
VSE 60/3T-D
~ Ballasts for outdoor use.
~ Vacuum impregnated with polyester resin and encapsulated in
polyurethane resin.
~ Reactancias para uso exterior.
~ Impregnadas al vacío en resina de poliéster y encapsuladas en
resina de poliuretano.
~ Thermal class tw=130°C.
~ Clase térmica tw=130°C.
~ Casing made of thermoplastic material
~ Available with 2.5 mm2 and 4 mm2, screw connection for
powers of up to 100W and between 150 and 400 respectively.
~ Also manufactured with incorporated thermal protection.
To request this add the letter P to the end of each type
(e.g. VSE 25/22-3T-D-P).
~ Further voltages and frequencies can be manufactured upon
request.
~ Envolvente de material termoplástico.
~ Con bornera de conexión por tornillo, de 2,5 mm2 y 4 mm2 para
las potencias hasta 100W y entre 150 y 400W
respectivamente.
~ También se fabrican con protección térmica incorporada.
2CTCUQNKEKVCTNCUCÌCFKTNCNGVTCŌ2CNſPCNFGECFCVKRQ
(Ejem.: VSE 25/22-3T-D-P).
~ Bajo demanda se pueden fabricar de otras tensiones y
frecuencias.
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
1
1
2
R
3
L
L
R
3
2
C
C
EN-61347-2-9
EN-60923
Negro
(Black)
Azul
(Blue)
N
N
196
3
1
3
Rojo
(Red)
R
1
L
2
RL N
C
AVS 100...
N
A
AVS-400-D
AVS-1000
www.elt.es
#UUGODNKGUHQTJKIJRTGUUWTGUQFKWOXCRQWTNCORU
Equipos completos para lámparas de vapor de sodio a alta presión
B
L1
L2
A1
58
A2
6
Model
Modelo
Ref. No.
VSI 5/23-2AF
Lamp
Supply
Lámpara
Línea
Power
Potencia
Current
Current
Intensidad Intensidad
Power
factor
Factor de
potencia
ţV
&KOGPUKQPU
Index
Dimensiones
Índice
Approvals
Homologaciones
B
L1 L2
A1 A2
mm mm mm mm mm
EEI
W
A
A
NJ
K
50
0,76
0,28
0,90 + 0,05
50
62
120
72
85
106
A3
-
VSI 7/23-3AF
6212251
70
0,98
0,40
0,90 + 0,05
70
62
120
72
85
106
A3
(*)
01
VSI 7/23-3AF-100
6212610
70
0,98
0,40
0,90 + 0,05
70
62
120
72
85
106
A3
(*)
01
VSI 10/23-2AF-100
6212210
100
1,20
0,55
0,90 + 0,05
70
62
120
72
105
126
A3
(*)
01
VSI 15/23-3AF-100
6212620
150
1,80
0,78
0,90 + 0,05
70
87
145
94
96
115
A3
(*)
01
VSI 25/23-3AF-100
6212230
250
3,00
1,33
0,90 + 0,05
65
87
145
94
116
135
A3
(*)
01
VSI 40/23-2AF-100
6212491
400
4,45
1,95
0,90 + 0,05
80
87
145
94
146
165
A2
(*)
01
~ Built-in use control gear including ballast, pulse transformer ignitor
and power factor correction capacitor.
~ Vacuum impregnated with polyester resin
~ Thermal class tw=130°C.
~ Available with 2,5 mm2 and 4 mm2 screw connection for powers
of up to 100W and between 150 and 400W respectively.
~ Availability of easy-to-uninstall components to relocate in
reduced spaces.
~ Also manufactured with built-in thermal protection or with
independent or superimposed ignitor.
~ Further voltages or frequencies can be manufactured upon
request.
~ Equipos a incorporar con reactancia, arrancador de tipo
dependiente (o transformación) y condensador de corrección del f.
de p.
~ Reactancias impregnadas al vacío en resina de poliéster
~ Clase térmica tw=130°C.
~ Con bornera de conexión por tornillo, de 2,5 mm2 y 4 mm2 para las
potencias hasta 100W y entre 150 y 400W respectivamente.
~ Disposición de los componentes fácilmente desmontable para
reubicar en espacios reducidos.
~ También se fabrican con protección térmica incorporada o con
arrancador de tipo independiente o superposición.
~ Bajo demanda se pueden fabricar de otras tensiones y frecuencias.
* Certifed components by their own
%QORQPGPVGUEGTVKſECFQURQTUGRCTCFQ
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
L
EN-61347-2-9
EN-61347-2-1
EN-61048
EN-60923
EN-60927
EN-61049
www.elt.es
1
197
~
N
2
3
4
5
VSI-AF
230V
50Hz
VSI-ARCE
230V
50Hz
Compact assemblies for high pressure sodium vapour lamps
Equipos completos enchufables para lámparas
de vapor de sodio a alta presión
B
L2
L1
6
51
B
L2
5
L1
6
61
5
6
A
A
7
6
150 - 250, 400 y 600W
50, 70 y 100W
WITH IMPULSE TRANSFORMER SYSTEM / CON ARRANCADOR DEPENDIENTE
Model
Modelo
Ref.
No.
Lamp
Supply
Lámpara
Línea
ţV
Dimensiones
Power
Power
Current
Current
factor
Potencia Intensidad Intensidad Factor de
potencia
W
A
A
Wiring
diagram
Dimensions
A
B
L1 L2
mm mm mm mm
K
NJ
Index
Esquema
conexión
Índice
nº
EEI
Approvals
Homolog.
VSI 7/23-ARCE-100
6212704
70
0,98
0,40
0,90 + 0,05
70
62
81
85
158
2
A3
(*)
01
VSI 10/23-ARCE-100
6212713
100
1,20
0,55
0,90 + 0,05
70
62
81
105
178
2
A3
(*)
01
VSI 15/23-ARCE-100
6212730
150
1,80
0,79
0,90 + 0,05
75
87
76
96
175
1
A3
01
VSI 25/23-ARCE-100
6212780
250
3,00
1,33
0,90 + 0,05
65
87
76
116
195
1
A3
01
VSI 40/23-ARCE-100
6212790
400
4,45
2,05
0,90 + 0,05
80
87
76
146
225
1
A2
VSI 60/3T-D-ARCE-100
6212802
600
6,10
3,10
0,90 + 0,05
70
105
91,5
214
231
1
A2
01
(*)
01
WITH DIGITAL IGNITOR PULSE-PAUSE OPERATION / CON ARRANCADOR DEPENDIENTE DIGITAL TEMPORIZADO
VSI 5/23-ARCE-100-DP
6212686
50
0,76
0,28
0,90 + 0,05
60
62
81
85
158
2
A3
(*)
01
VSI 7/23-ARCE-150
6212705
70
0,98
0,40
0,90 + 0,05
70
62
81
85
158
2
A3
(*)
01
VSI 10/23-ARCE-150
6212714
100
1,20
0,55
0,90 + 0,05
70
62
81
105
178
2
A3
(*)
01
VSI 15/23-ARCE-150
6212731
150
1,80
0,79
0,90 + 0,05
75
87
76
96
175
1
A3
01
VSI 25/23-ARCE-400
6212781
250
3,00
1,33
0,90 + 0,05
65
87
76
116
195
1
A3
01
VSI 40/23-ARCE 400
6212791
400
4,45
2,05
0,90 + 0,05
80
87
76
146
225
1
A2
01
~ Pluggable equipment with ballast and subset comprising of
ignitor and power factor correction capacitor for built-in use.
~ Vacuum impregnated with polyester resin.
~ Thermal class tw=130°C.
~ With 2.5 mm2 screw connection.
~ To ensure earth connection continuity, it is necessary to use the
EGPVTCNſZKPIRQKPVVQLQKPVVJGDCNNCUVCPFVJGRNWIICDNGUWDUGV
~ Also manufactured with incorporated thermal protection.
To request this add the letter -P to the end of each type
(e.g. VSI 15/23-ARCE-150-P).
~ Further voltages or frequencies can be manufactured upon
request.
~ Equipos a incorporar con reactancia y subconjunto enchufable que
incorpora arrancador y condensador de corrección del f. de p.
~ Reactancias impregnadas al vacío en resina de poliéster.
~ Clase térmica tw=130°C.
~ Con bornera de conexión por tornillo de 2,5 mm2.
~ Para asegurar la continuidad de la toma de tierra, indispensable
utilizar el anclaje central de unión entre reactancia y subconjunto
enchufable.
~ También se fabrican con protección térmica incorporada.
Para solicitar debe añadir la letra –P.
(Ejemp. VSI 15/23-ARCE-150-P).
~ Bajo demanda se pueden fabricar en otras tensiones y frecuencias.
* Only the ballast
* Sólo la reactancia
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
1
L
EN-61347-2-9
EN-61347-2-1
EN-60923
EN-60927
1
198
~
2
N
2
L
3
4
5
1
~
N
2
3
4
5
www.elt.es
%QORCEVCUUGODNKGUHQTJKIJRTGUUWTGUQFKWOXCRQWT
CPFOGVCNJCNKFGNCORU4GFWEGFUGEVKQP
Equipos completos enchufables para lámparas de vapor de sodio
alta presión y halogenuros metálicos. Sección reducida
57
VSI-SC-ARCE
230V
50Hz
53
L1
L2
8
6,2
66
Lamp
Voltage
Frecuency
Model
Modelo
Ref. No.
Tensión
Frecuencia
Lámpara
ţV
Power
Current
Potencia Intensidad
Power
factor
/CKPU
current
Factor de
potencia
Corriente
en red
&KOGPUKQPU Index
Dimensiones
Índice
Approvals
Homologaciones
V/Hz
W
A
K
NJ
A
L1
mm
L2
mm
EEI
VSI 15/23-SC-ARCE-DP
6212840
230/50
150
1,80
70
0,90 + 0,05
0,79
205
121
A3
(*)
01
(1)VHI 25/23-SC-ARCE-002
6212778
230/50
250
2,13
75
0,90 + 0,05
1,28
205
121
A2
(*)
01
VHI 25/23-SC-ARCE-DP
6212777
230/50
250
2,13
75
0,90 + 0,05
1,28
205
121
A2
(*)
01
~ Ballasts, ignitor, compensation capacitor as a compact control gear
units for high pressure sodium vapour and metal halie lamps.
`(QTGODQFKOGPVYKVJKPſVVKPIUDQZGUQTECDKPGVUCUCFFKVKQPCN
protection.
`'CU[KPUVCNNCVKQP6JGTGKUCUKIPKſECPVTGFWEVKQPKPCUUGODN[VKOG
and costs.
~ Thermal class tw=130°C.
~ Vacuum impregnated in polyester resin.
~ Ignitor and capacitor, are encapsulated in poliuretane electrical
resin.
~ Screw terminals: 2,5 mm2 .
~ Further voltages and frequencies can be manufactured upon
request.
~ These ballasts are also available with thermal protector. In such
case add “P”
(e.g. VSI 15/23-SC-ARCE-DP-P)
~ To ensure earth connection continuity, it is necessary to use the
EGPVTCNſZKPIRQKPVVQLQKPVVJGDCNNCUVCPFVJGRNWIICDNGUWDUGV
~ Equipos completos compuestos de reactancias, arrancador y
condensador de corrección del factor de potencia para lámparas de
vapor de sodio alta presión y halogenuros metálicos.
~ Uso interior. Para incorporar en luminarias, cajas o cofres, como
protección adicional.
~ Gran rapidez de instalación. Solo conectar línea y lámpara.
~ Impregnadas al vacío en resina de poliéster.
~ Clase térmica tw=130°C.
~ El subconjunto arrancador / condensador, encapsulados en resina
de poliuretano.
~ Clema de conexión por tornillo: 2,5 mm2.
~ Bajo demanda se pueden fabricar para otras tensiones y
frecuencias.
~ Estos equipos se fabrican también con protección térmica. Para
solicitarlos añadir al tipo la letra “P”
(Ejemplo: VSI 15/23-SC-ARCE-DP-P)
~ Para asegurar la continuidad de la toma a tierra, indispensable
utilizar el anclaje central de unión entre reactancia y subconjunto
GPEJWHCƀG
%GTVKſGFDCNNCUV
(1)
Valid for lamps starting up from 0,6-0,8 Kv
4GCEVCPEKCEGTVKſECFC
(1)
Válido para lámparas de encendido 0,6-0,8 Kv.
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
EN-61347-2-9
EN-61347-2-1
EN-60923
EN-60927
www.elt.es
L
199
~
N
VSE-BOX
230V
50Hz
%QPVTQNIGCTHQTJKIJRTGUUWTGUQFKWONCORUKP+2DQZ
Equipos completos en cofre IP65 para lámparas de
vapor de sodio alta presión
180
370
–5
290
–2
172 213
HIGH PRESSURE SODIUM VAPOUR LAMPS / LAMPARAS VAPOR SODIO ALTA PRESION
Model
Modelo
Lamp
Supply
Lámpara
Línea
Power factor
Ref. No.
Power
Potencia
Current
Intensidad
Voltage
Tensión
Current
Intensidad
Factor de
potencia
%CRCEKVQT
for HPF
Condensador
AF
+IPKVQT
Arrancador
Index
Índice
W
A
V
A
NJ
z(v8
VSE 60/23-100-AF
6210751
600
6,10
230
3,1
0,90 + 0,05
65/250
AVS 100-D
VSE 60/23-1000-AF
6210753
600
6,10
230
3,1
0,90 + 0,05
65/250
AVS 1000
A2
VSE 100/23-100-AF
6210323
1000
10,30
230
5
0,90 + 0,05
100/250
AVS 100-D
A2
VSE 100/23-1000-AF
6210322
1000
10,30
230
5
0,90 + 0,05
100/250
AVS 1000
A2
EEI
A2
~ Assembles comprising of ballast, power factor correction
capacitor for outdoor use.
~ All components incorporated in an aluminium box injected with
UGCNCPFUVWHſPIYJKEJRTQXKFGU+2RTQVGEVKQPKPFGZ
~ Further voltages and frequencies can be manufactured upon
request.
~ Thermal class tw=130°C.
~ Montajes de reactancia, arrancador y condensador de corrección
del f. de p. para intemperie.
~ Incorpora todos los componentes en una caja de aluminio
inyectado con juntas de estanqueidad y prensaestopas que le
EQPſGTGPWPÈPFKEGFGRTQVGEEKÎP+2
~ Bajo demanda se pueden fabricar de otras tensiones y
frecuencias.
~ Clase térmica tw=130°C.
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
EN-61347-2-9
EN-61347-2-1
EN-60923
EN-60927
RED
L
200
N
www.elt.es
$CNNCUVUHQTJKIJRTGUUWTGUQFKWOXCRQWTNCORU
DKRQYGTU[UVGO
Reactancias para lámparas de vapor de sodio alta presión
doble nivel de potencia
B
B
L2
L1
6
51
VSI-2P-RASE
230V
50Hz
L2
L1
5
6
6
41
5
6,5
A
A
70 y 100W
150 - 250 y 400W
NJ
A
B
L1 L2
mm mm mm mm
Homologaciones
K
Índice
W
Approvals
W
Index
A
Esquema conexión
A
9KTKPIFKCITCO
W
Dimensiones
ţV
Power
/CZKOWO Reduced
Potencia
level
level
Nivel
Nivel
máximo
reducido
&KOGPUKQPU
Reduced level
Nivel reducido
Modelo
Current
Intensidad
Ref.
No.
/CZKOWONGXGN
Nivel máximo
Model
Power factor
Supply
Power
Línea
Potencia
Lamp
Lámpara
Factor de potencia
WITH COMMAND WIRES / CON LÍNEA DE MANDO
nº
EEI
VSI 5/23-2P-RASE-CA
6114653
50
0,76
0,56
61
37
60
0,34
62
78
85
158
2
A3
*VSI 7/23-2P-RSE-CA
6114502
70
1,00
0,75
83
50
60
0,36
62
78
105
178
1
A3
01
VSI 7/23-2P-RASE-CA
6114503
70
1,00
0,75
83
50
60
0,36
62
78
105
178
2
A3
01
VSI 10/23-2P-RASE-CA
6114671
100
1,20
0,92
116
72
65
0,44
62
78
105
178
2
A3
01
VSI 15/23-2P-RASE-CA
6114681
150
1,80
1,30
168
100
70
0,40
87
89
96
156
3
A3
01
VSI 25/23-2P-RASE-CA
6114701
250
3,00
2,35
278
165
70
0,42
87
89
116
176
3
A3
01
VSI 40/23-2P-RASE-CA
6114711
400
4,45
3,65
435
262
75
0,45
87
89
146
206
3
A2
01
-
WITHOUT COMMAND WIRES / SIN LÍNEA DE MANDO
VSI 5/23-2P-RASE-CA-SM
6114654
50
0,76
0,56
61
37
60
0,34
62
78
85
158
5
A3
*VSI 7/23-2P-RME-SM
6114500
70
1,00
0,75
83
50
60
0,36
62
78
105
178
4
A3
01
VSI 7/23-2P-RASE-SM
6114501
70
1,00
0,75
83
50
60
0,36
62
78
105
178
5
A3
01
VSI 10/23-2P-RASE-CA-SM
6114670
100
1,20
0,92
116
72
65
0,44
62
78
105
178
5
A3
01
VSI 15/23-2P-RASE-CA-SM
6114680
150
1,80
1,30
168
100
70
0,40
87
89
96
156
6
A3
01
VSI 25/23-2P-RASE-CA-SM
6114700
250
3,00
2,35
278
165
70
0,42
87
89
116
176
6
A3
01
VSI 40/23-2P-RASE-CA-SM
6114710
400
4,45
3,65
435
262
75
0,45
87
89
146
206
6
A2
01
~ Ballasts for built-in use.
~ The 100% of the lamp power is obtained by applying the control voltage
accross command line. Should you need the oppossite sequence please
request “CC” type instead of “CA” type.
~ With double level ballast and pluggable subset comprising of an digitally timed
pulse type ignitor and relay to switch power level. For built-in use.
`6QGPUWTGGCTVJEQPPGEVKQPEQPVKPWKV[KVKUPGEGUUCT[VQWUGVJGEGPVTCNſZKPI
point to joint the ballast and the pluggable subset.
~ Also manufactured with incorporated thermal protection.
~ Vacuum impregnated with polyester resin
~ Thermal class tw=130°C.
~ Available with 2,5 mm2 screw connection.
~ For installations with the control line deactivated at maximum power level, type
CC can be manufactured (closed contact relay).
`6JGOQFGNUYKVJQWVEQPVTQNNKPG
5/CTGOCPWHCEVWTGFYKVJCſZGFVKOKPIQH
4hrs 30mins, during which the lamp is at maximum level and after which, the
lamp changes to a reduced level.
* Without ignitor in lamps with internal ignitor.
~ Reactancias a incorporar
~ Equipos con el 100% de la potencia en lámpara con tensión en
el mando. Si se desea lo contrario, sustituir en la denominación “CA” por “.CC”.
~ Equipos con reactancia de doble nivel y subconjunto enchufable que incorpora
arrancador de tipo dependiente pulso-pausa y relé para conmutación del nivel
de potencia. Uso interior.
~ Para asegurar la continuidad de la toma de tierra, indispensable utilizar el
anclaje central de unión entre reactancia y subconjunto enchufable.
~ También se fabrican con protección térmica incorporada.
~ Reactancias impregnadas al vacío en resina de poliéster.
~ Clase térmica tw=130°C.
~ Con bornera de conexión por tornillo, de 2,5 mm2.
~ Para instalaciones con linea de mando desactivada en nivel maximo de
potencia se pueden fabricar del tipo CC (relé contacto cerrado).
`.QUOQFGNQUUKPNÈPGCFGOCPFQ
5/UGHCDTKECPEQPWPCVGORQTK\CEKÎPſLCFG
4h30’, durante las cuales la lámpara permanece a nivel máximo; pasado este
tiempo, cambia a nivel reducido.
* Sin arrancador para lámpara con arrancador interno.
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
Detailed explanation of the operation page 238
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
Explicación detallada del funcionamiento página 238
1
2
1 2 3 4 5 6 7 8
Cco
www.elt.es
1 2 3 4 5
C1
4
4
5
C1
C1
Control
N
EN-61347-2-9
EN-60923
EN-61347-2-11
1 2 3
6 7
Control
230V
L
3
8 9 10 11 12
Cco
L
N
0 1 2 3 4 5 6 7 8
Cco
N
5
8 9 10 11 12
Cco
1 2 3
4
5
C1
L N
201
C1
Control
L
6
8 9 10 11 12
Cco
L
N
0 1 2 3
Cco
4 5 6 7 8
C1
N
L
$CNNCUVUHQTJKIJRTGUUWTGUQFKWOXCRQWTNCORU
DKRQYGTU[UVGO5/+
Reactancias para lámparas de vapor de sodio alta presión
doble nivel de potencia SMI
B
L2
L1
6
51
B
L1
5
6
L2
6
41
5
6,5
A
A
70 y 100W
150 - 250 y 400W
K
NJ
A
B
L1 L2
mm mm mm mm
nº
EEI
Homologaciones
W
Índice
W
Approvals
A
Index
A
Esquema conexión
W
Power
/CZKOWO Reduced
Potencia
level
level
Nivel
Nivel
máximo
reducido
9KTKPIFKCITCO
ţV
Dimensiones
Current
Intensidad
&KOGPUKQPU
Modelo
Ref.
No.
Reduced level
Nivel reducido
Model
Power factor
Supply
Power
Línea
Potencia
Lamp
Lámpara
Factor de potencia
WITHOUT COMMAND WIRES ASTROMICAL RESPONSE - SMI / SIN LÍNEA DE MANDO RESPUESTA ASTRONÓMICA - SMI
/CZKOWONGXGN
Nivel máximo
VSI-2PRASE-SMI
230V
50Hz
VSI 5/23-2P-RASE-SMI
6114655
50
0,76
0,56
61
37
60
0,34
62
78
85
158
2
A3
VSI 7/23-2P-RASE-SMI
6114725
70
1,00
0,75
83
50
60
0,36
62
78
105
178
2
A3
01
VSI 10/23-2P-RASE-SMI
6114665
100
1,20
0,92
116
72
65
0,44
62
78
105
178
2
A3
01
VSI 15/23-2P-RASE-SMI
6114595
150
1,80
1,30
168
100
70
0,40
87
89
96
156
1
A3
01
VSI 25/23-2P-RASE-SMI
6114927
250
3,00
2,35
278
165
70
0,42
87
89
116
176
1
A3
01
VSI 40/23-2P-RASE-SMI
6114736
400
4,45
3,65
435
262
75
0,45
87
89
146
206
1
A2
01
~ Thermal class tw=130°C.
~ Reactancias a incorporar.
~ Equipos de doble nivel de potencia con respuesta astronómica.No necesitan
linea de mando.
~ Reactancia de doble nivel de potencia con subconjunto enchufable que
incorpora arrancador temporizado pulso-pausa y relé de conmutación. Uso
interior.
~ Encendido al 100% de la potencia y ajuste automático del paso a nivel
TGFWEKFQRCTCNCRCTVGEGPVTCNFGNCPQEJG'ſEKGPEKCQRVKOK\CFCRCTCEWCNSWKGT
duración de la noche.
~ Paso automático a nivel reducido en caso de sobretensión de red superior al
12%, para evitar sobrecargas y alargar la vida de las lámparas.
~ Este producto cumple tecnológicamente con los criterios de referencia,
indicativos de las mejoras tecnológicas disponibles, recogidos en el reg.
245/2009 que aplica la Directiva de Eco-Diseño.
~ Para asegurar la continuidad de la toma de tierra es indispensable utilizar el
anclaje central de unión entre reactancia y subconjunto enchufable.
~ Validos también para lámparas de halogenuros con quemador cerámico que
permitan regulación.
~ Clase térmica tw=130°C.
Detailed explanation of the operation page 239
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
Explicación detallada del funcionamiento página 239
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
~ Ballasts for built-in use.
~ Bi-power control gear with astronomical response. Additional control line is not
required.
~ The control gear consists of bi-power ballast and auxiliary box containing
digitally timed pulse ignitor and relay.
~ Lamp ignition at full power under any circunstance and automatic changeover
to low level during the central part of the night. Optimized saving time for any
duration of the night.
~ Automatic changeover to high impedance level when input voltage is 12%
higher than nominal value avoiding over voltage stress and life reduction of the
lamps.
`6JKUHCOKN[QHRTQFWEVUHWNſNVJGTGHGTGPEGETKVGTKCHQTDGUVCXCKNCDNGVGEJPQNQIKGU
as per commission regulation (EC) n . 245/2009 implementing Ecodesign
Directive.
`+VKUGUUGPVKCNVJGWUGQHVJGſZKPIRQKPVNQECVGFDGVYGGPDCNNCUVCPFCWZKNKCT[
box to assure earth continuity.
~ Suitable to be used with metal halide lamps of ceramic burner that allow
dimming.
Response in Helsinki
Comportamiento en Helsinki
16
18
20
22
24
2
4
Responde in Madrid
Comportamiento en Madrid
6
8
10 h.
18
January
Enero
20
22
24
2
4
6
8
10 h.
January
Enero
100%
W Lamp
60%
W Lamp
December
Diciembre
December
Diciembre
2
1
EN-61347-2-9
EN-60923
EN-61347-2-11
0 1 2 3
Cco
4 5 6 7 8
C1
202
N
L
1 2 3 4 5
C1
8 9 10 11 12
Cco
L N
www.elt.es
$CNNCUVUHQTJKIJRTGUUWTGUQFKWOXCRQWTNCORUDKRQYGT
U[UVGO5/+YKVJVJGTOCNRTQVGEVKQP
Reactancias para lámparas de vapor de sodio alta presión.
Doble nivel de potencia SMI
con protección térmica
B
L2
L1
6
51
VSI-2PRASE-SMI-P
230V
50Hz
B
L1
5
6
L2
6
41
5
6,5
A
A
70 y 100W
150 - 250 y 400W
NJ
A
B
L1 L2
mm mm mm mm
Homologaciones
K
Índice
W
Approvals
W
Index
A
Esquema conexión
A
9KTKPIFKCITCO
W
Dimensiones
ţV
Power
/CZKOWO Reduced
Potencia
level
level
Nivel
Nivel
máximo
reducido
&KOGPUKQPU
Current
Intensidad
Reduced level
Nivel reducido
Modelo
Ref.
No.
/CZKOWONGXGN
Nivel máximo
Model
Power factor
Supply
Power
Línea
Potencia
Lamp
Lámpara
Factor de potencia
WITHOUT COMMAND WIRES ASTROMICAL RESPONSE - SMI / SIN LÍNEA DE MANDO RESPUESTA ASTRONÓMICA - SMI
nº
EEI
VSI 7/23-2P-RASE-SMI-P
6114726
70
1,00
0,75
83
50
60
0,36
62
78
105
178
2
A3
01
VSI 10/23-2P-RASE-SMI-P
6114664
100
1,20
0,92
116
72
65
0,44
62
78
105
178
2
A3
01
VSI 15/23-2P-RASE-SMI-P
6114597
150
1,80
1,30
168
100
70
0,40
87
89
96
156
1
A3
01
VSI 25/23-2P-RASE-SMI-P
6114929
250
3,00
2,35
278
165
70
0,42
87
89
116
176
1
A3
01
VSI 40/23-2P-RASE-SMI-P
6114738
400
4,45
3,65
435
262
75
0,45
87
89
146
206
1
A2
01
~ Ballasts for built-in use.
~ Bi-power control gear with astronomical response. Additional control line is not
required.
~ Control gear including bi-power ballast with thermal protection and auxiliary box
containing digitally timed pulse ignitor and relay. For built-in use.
~ Lamp ignition at full power under any circunstance and automatic changeover
to low level during the central part of the night. Optimized saving time for any
duration of the night.
~ Automatic changeover to high impedance level when input voltage is 12%
higher than nominal value avoiding over voltage stress and life reduction of the
lamps.
`6JKUHCOKN[QHRTQFWEVUHWNſNVJGTGHGTGPEGETKVGTKCHQTDGUVCXCKNCDNGVGEJPQNQIKGU
as per commission regulation (EC) n . 245/2009 implementing Ecodesign
Directive.
`+VKUGUUGPVKCNVJGWUGQHVJGſZKPIRQKPVNQECVGFDGVYGGPDCNNCUVCPFCWZKNKCT[
box to assure earth continuity.
~ Suitable to be used with metal halide lamps of ceramic burner that allow
dimming.
~ Thermal class tw=130°C.
~ Reactancias a incorporar.
~ Equipos de doble nivel de potencia con respuesta astronómica.No necesitan
linea de mando.
~ Reactancia de doble nivel de potencia con protección térmica y subconjunto
enchufable que incorpora arrancador temporizado pulso-pausa y relé de
conmutación. Uso interior.
~ Encendido al 100% de la potencia y ajuste automático del paso a nivel
TGFWEKFQRCTCNCRCTVGEGPVTCNFGNCPQEJG'ſEKGPEKCQRVKOK\CFCRCTCEWCNSWKGT
duración de la noche.
~ Paso automático a nivel reducido en caso de sobretensión de red superior al
12%, para evitar sobrecargas y alargar la vida de las lámparas.
~ Este producto cumple tecnológicamente con los criterios de referencia,
indicativos de las mejoras tecnológicas disponibles, recogidos en el reg.
245/2009 que aplica la Directiva de Eco-Diseño.
~ Para asegurar la continuidad de la toma de tierra es indispensable utilizar el
anclaje central de unión entre reactancia y subconjunto enchufable.
~ Validos también para lámparas de halogenuros de quemador cerámico que
permitan regulación.
~ Clase térmica tw=130°C.
Detailed explanation of the operation page 239
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
Explicación detallada del funcionamiento página 239
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
Response in Helsinki
Comportamiento en Helsinki
16
18
20
22
24
2
4
6
Responde in Madrid
Comportamiento en Madrid
8
10 h.
18
January
Enero
20
22
24
2
4
6
8
10 h.
January
Enero
100%
W Lamp
60%
W Lamp
December
Diciembre
December
Diciembre
2
1
EN-61347-2-9
EN-60923
EN-61347-2-11
www.elt.es
0 1 2 3
Cco
4 5 6 7 8
C1
203
N
L
1 2 3 4 5
C1
8 9 10 11 12
Cco
L N
$CNNCUVUHQTJKIJRTGUUWTGUQFKWOXCRQWTNCORU
$KRQYGTU[UVGO
Reactancias para lámparas de vapor de sodio alta presión
Doble nivel de potencia
B
A1
A2
8
L2
L1
6
6,5
6,5
K
NJ
A1 A2
B
L1 L2
mm mm mm mm mm
nº
Homologaciones
W
Índice
W
Approvals
A
Index
A
Esquema conexión
W
9KTKPIFKCITCO
ţV
Power
/CZKOWO Reduced
Potencia
level
level
Nivel
Nivel
máximo
reducido
Dimensiones
Current
Intensidad
&KOGPUKQPU
Modelo
Ref.
No.
Reduced level
Nivel reducido
Model
Power factor
Supply
Power
Línea
Potencia
Lamp
Lámpara
Factor de potencia
WITH COMMAND WIRES - With superimposed ignitor / CON LÍNEA DE MANDO - Con arrancador de tipo independiente
/CZKOWONGXGN
Nivel máximo
VSI-2P-CA
230V
50Hz
EEI
VSI 7/23-2P-CA-400
6114622
70
1,00
0,75
83
50
60
0,36
62
120
77
105
126
2
A3
01
VSI 10/23-2P-CA-400
6114581
100
1,20
0,92
116
72
65
0,44
62
120
77
105
126
2
A3
01
VSI 15/23-2P-CA-400
6114982
150
1,80
1,30
168
100
70
0,40
87
145
94
96
115
2
A3
01
VSI 25/23-2P-CA-400
6114561
250
3,00
2,35
278
165
70
0,42
87
145
94
116
135
2
A3
01
VSI 40/23-2P-CA-400
6114692
400
4,45
3,65
435
262
75
0,45
87
145
94
146
165
2
A2
01
WITHOUT COMMAND WIRES - With superimposed ignitor
SIN LÍNEA DE MANDO -SM- (TEMPORIZADOS)- Con arrancador de tipo independiente
VSI 7/23-2P-CA-400-SM
6114619
70
1,00
0,75
83
50
60
0,36
62
120
77
105
126
1
A3
01
VSI 10/23-2P-CA-400-SM
6114902
100
1,20
0,92
116
72
65
0,44
62
120
77
105
126
1
A3
01
VSI 15/23-2P-CA-400-SM
6114912
150
1,80
1,30
168
100
70
0,40
87
145
94
96
115
1
A3
01
VSI 25/23-2P-CA-400-SM
6114923
250
3,00
2,35
278
165
70
0,42
87
145
94
116
135
1
A3
01
VSI 40/23-2P-CA-400-SM
6114699
400
4,45
3,65
435
262
75
0,45
87
145
94
146
165
1
A2
01
~ Equipment with double level ballast and pluggable subset
comprising of an independent type ignitor and relay to switch
power level. For built-in use.
~ Thermal class tw=130°C.
~ Vacuum impregnated with polyester resin.
~ Available with 2.5 mm2 and 4 mm2 screw connection for powers
of up to 100W and between 150 and 400W respectively.
~ Availability of easy-to-uninstall components to relocate in
reduced spaces.
The models without control line (SM) are manufactured with a
ſZGFVKOKPIQHJTUOKPUFWTKPIYJKEJVJGNCORKUCV
maximum level and after which, the lamp changes to a reduced
level.
~ For installations with the control line deactivated at maximum
power level, type CC can be manufactured (closed contact relay).
~ Further voltages, frequencies and other timings can be
manufactured upon request.
~ Suitable to be used with metal halide lamps of ceramic burner that allow
dimming.
~ Equipos con reactancia de doble nivel, arrancador de tipo
independiente y relé para conmutación del nivel de potencia. Reactancias a
incorporar
~ Reactancias impregnadas al vacío en resina de poliéster.
~ Clase térmica tw=130°C.
~ Con bornera de conexión por tornillo, de 2,5 mm2 y 4 mm2 para
las potencias hasta 100W y entre 150 y 400W respectivamente.
~ Disposición de los componentes fácilmente desmontable para
reubicar en espacios reducidos.
~ Los modelos sin línea de mando (SM) se fabrican con una
VGORQTK\CEKÎPſLCFGJŏFWTCPVGNCUEWCNGUNCN¶ORCTC
permanece a nivel máximo; pasado este tiempo, cambia a nivel
reducido.
~ Para instalaciones con línea de mando desactivada en nivel
máximo de potencia se pueden fabricar del tipo CC
(relé contacto cerrado).
~ Bajo demanda se pueden fabricar de otras tensiones y
frecuencias o de otras temporizaciones.
~ Validos también para lámparas de halogenuros de quemador cerámico que
permitan regulación.
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
2
1
L
EN-61347-2-9
EN-61347-2-1
EN-60923
EN-60927
EN-61347-2-11
L
N
N
Control
1
2
204
3
Cco
C1
Cco
C1
4
5
1
2
3
4
5
6
7
www.elt.es
$CNNCUVUHQTJKIJRTGUUWTGUQFKWOXCRQWTNCORU
$KRQYGTU[UVGO+2
Reactancias para lámparas de vapor de sodio alta presión Clase II
Doble nivel de potencia IP54
–16,5
A
A1
VSE-2P-C2
230V
50Hz
B
10
L1LT
A2
250
ta (°C)
NJ
A/A 2 A 1
B
L1 LT
mm mm mm mm mm
Índice
W
Index
W
Esquema conexión
A
9KTKPIFKCITCO
A
Dimensiones
W
Power
/CZKOWO Reduced
Potencia
level
level
Nivel
Nivel
máximo
reducido
&KOGPUKQPU
Factor de potencia
Power factor
Current
Intensidad
Reduced level
Nivel reducido
Modelo
Ref.
No.
/CZKOWONGXGN
Nivel máximo
Model
1RGTCVKPIVGOR
Supply
Power
Línea
Potencia
Lamp
Lámpara
Temp. funcionamiento
WITH COMMAND WIRES - With pulse-transformer ignitor models
CON LÍNEA DE MANDO - Modelos con arrancador de transformación de impulsos
nº
EEI
*VSE 7/23-2P-C2-AF s/arr.
6218200
70
1,00
0,75
83
50
50
0,95
68/84
56
62
171
183
1
A3
VSE 7/23-2P-C2-AF
6218251
70
1,00
0,75
83
50
50
0,90
92/97
76
83
155
172
1
A3
VSE 10/23-2P-C2-AF
6218210
100
1,20
0,92
116
72
50
0,90
92/97
76
83
155
172
1
A3
A3
VSE 15/23-2P-C2-AF
6218220
150
1,80
1,30
168
100
50
0,95
92/97
76
83
155
172
1
VSE 25/23-2P-C2-AF
6218230
250
3,00
2,35
278
165
50
0,95
92/97
76
83
175
192
1
A3
VSE 40/23-2P-C2-AF
6218240
400
4,45
3,65
435
262
45
0,90
92/97
76
83
205
222
1
A2
A3
WITHOUT COMMAND WIRES - With pulse-transformer ignitor models
SIN LÍNEA DE MANDO - Modelos con arrancador de transformación de impulsos
70
1,00
0,75
83
50
50
0,90
92/97
76
83
155
172
2
VSE 7/23-2P-C2-AF-SM
*VSE 7/23-2P-C2-AF-SM s/arr.
6218250
70
1,00
0,75
83
50
50
0,90
92/97
76
83
155
172
2
A3
VSE 10/23-2P-C2-AF-SM
6218211
100
1,20
0,92
116
72
50
0,90
92/97
76
83
155
172
2
A3
VSE 15/23-2P-C2-AF-SM
6218221
150
1,80
1,30
168
100
50
0,95
92/97
76
83
155
172
2
A3
VSE 25/23-2P-C2-AF-SM
6218231
250
3,00
2,35
278
165
50
0,95
92/97
76
83
175
192
2
A3
VSE 40/23-2P-C2-AF-SM
6218241
400
4,45
3,65
435
262
45
0,90
92/97
76
83
205
222
2
A2
~ IP54 equipment for outdoor use, comprising of a double level ballast, relay
to switch the power level and a power factor correction capacitor pulse
transformer temporized ignitor.
~ The 100% of the lamp power is obtained by applying the control voltage
accross command line.
`1WVFQQTWUG&KUVCPEGVQNCORŭOCNNQYGF
~ Ballasts vacuum impregnated with polyester resin and encapsulated in
polyurethane resin.
~ Thermal class tw=130°C.
~ Class II thermoplastic material casing.
~ Connection with double insulated cables, hose type.
~ Installed with wires downwards presenting IP54 protection index.
`6JGOQFGNUYKVJQWVEQPVTQNNKPG
5/CTGOCPWHCEVWTGFYKVJCſZGFVKOKPIQH
4hrs 30mins, during which the lamp is at maximum level and after which, the
lamp changes to a reduced level.
~ Further voltages, frequencies and other timings can be manufactured upon
request.
* Without ignitor in lamps with internal ignitor.
~ Equipos Clase II IP54 para intemperie que incorporan reactancia de doble
nivel, relé para conmutación del nivel de potencia, arrancador dependiente
temporizado y condensador de corrección del f. de p.
~ Se obtiene el 100% de la potencia en lámpara con tensión en el mando.
`7UQGZVGTKQT#FOKVGFKUVCPEKCUCN¶ORCTCŭOGVTQU
~ Reactancias impregnadas al vacío en resina de poliéster y encapsuladas en
resina de poliuretano.
~ Clase térmica tw=130°C.
~ Envolvente de material termoplástico de Clase II.
~ Con conexiones por cables de doble aislamiento, tipo manguera.
~ Colocadas con los cables hacia abajo presentan un índice de protección IP54.
`.QUOQFGNQUUKPNÈPGCFGOCPFQ
5/UGHCDTKECPEQPWPCVGORQTK\CEKÎPſLCFG
4h30’, durante las cuales la lámpara permanece a nivel máximo; pasado este
tiempo, cambia a nivel reducido.
~ Bajo demanda se pueden fabricar de otras tensiones y frecuencias o de otras
temporizaciones.
* Sin arrancador para lámpara con arrancador interno.
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
1
2
L
L
EN-61347-2-9
EN-60923
www.elt.es
N
205
(
Mando
N
%QORCEVCUUGODNKGUHQTJKIJRTGUUWTGUQFKWOXCRQWTNCORU
%NCUU+++2*KIJRQYGTHCEVQT
Equipos completos para lámparas de vapor de sodio alta presión
IP40 Clase II. Alto factor de potencia
A
A1
6, 5 –1
C2-AI
Format 1
Formato 1
B
L
L2 TR
10
L1 LT
–10
300
83
A2
Format 1
Formato 1
98,5
Format 2
Formato 2
C2-AI CLEMA
Format 3
Formato 3
0,28
0,90 + 0,05
60
VSI 5/23-C2-AI-CLEMA
50
0,76
0,28
0,90 + 0,05
VSI 5/23-C2S-AI
50
0,76
0,28
Homologaciones
0,76
Índice
50
Approvals
VSI 5/23-C2-AI
Index
K
Esquema conexión
NJ
9KTKPIFKCITCO
A
ţV
Dimensiones
A
Modelo
Ref.
No.
Formato
W
Model
Format
Línea
Power factor
Factor de potencia
Lámpara
Current
Intensidad
Supply
Current
Intensidad
Lamp
&KOGPUKQPU
CONTROL GEARS WITH PULSE-PAUSE DIGITAL OPERATION CAPACITOR (Max. load capacity: 2000pF)
CONJUNTOS CON ARRANCADOR DIGITAL TEMPORIZADO PULSO-PAUSA (Capacidad max. admisible cable: 2000pF)
Power
Potencia
VSI-C2-AI
230V
50Hz
B
L 1 L T L 2 L TR
A/A 2 A 1
mm mm mm mm mm mm mm
nº
EEI
1
69/84
56
62
171
183
-
-
1
A3
-
60
3
69/84
56
62
171
183
-
-
2
A3
-
0,90 + 0,05
60
2
69/84
56
62
-
-
106
118
1
A3
-
VSI 7/23-C2-AI
6211510
70
1,00
0,39
0,90 + 0,05
75
1
69/84
56
62
171
183
-
-
1
A3
01
VSI 7/23-C2-AI-CLEMA
6211529
70
1,00
0,39
0,90 + 0,05
75
3
69/84
56
62
171
183
-
-
2
A3
01
VSI 7/23-C2S-AI
6211520
70
1,00
0,39
0,90 + 0,05
75
2
69/84
56
62
-
-
106
118
1
A3
01
VSI 10/23-C2-AI
6212520
100
1,20
0,55
0,90 + 0,05
70
1
69/84
56
62
171
183
-
-
1
A3
01
100
1,20
0,55
0,90 + 0,05
70
3
69/84
56
62
171
183
-
-
2
A3
01
VSI 10/23-C2-AI-CLEMA
VSI 10/23-C2S-AI
6212530
100
1,20
0,55
0,90 + 0,05
70
2
69/84
56
62
-
-
106
118
1
A3
01
VSI 15/23-C2-AI
6212260
150
1,80
0,81
0,90 + 0,05
70
1
92/97
76
83
155
172
-
-
1
A3
01
VSI 15/23-C2S-AI
6212290
150
1,80
0,81
0,90 + 0,05
70
2
92/97
76
83
-
-
96
112
1
A3
01
VSI 25/23-C2-AI
6212270
250
3,00
1,31
0,90 + 0,05
70
1
92/97
76
83
175
192
-
-
1
A3
01
VSI 25/23-C2S-AI
6212300
250
3,00
1,31
0,90 + 0,05
70
2
92/97
76
83
-
-
116
191
1
A3
01
VSI 40/23-C2-AI
6212280
400
4,45
2,20
0,85
85
1
92/97
76
83
203
222
-
-
1
A2
01
VSI 40/23-C2S-AI
6212310
400
4,45
2,20
0,85
85
2
92/97
76
83
-
-
146
162
1
A2
01
~ Class II IP40 control gear including ballast and power factor
correction capacitor.
~ Ballasts vacuum impregnated with polyester resin and encapsulated
in polyurethane resin.
~ Thermal class tw=130°C.
~ Class II thermoplastic material casing.
~ With Class II anti-traction connector.
~ Available with thermal protection upon request. These types are
named adding -P (e.g. VSI 7/23-C2-AI-P).
~ Further voltages and frequencies can be manufactured upon
request.
~ Equipos Clase II IP40 que incluyen reactancia, arrancador y
condensador de corrección de f. de p.
~ Reactancias impregnadas al vacío en resina de poliéster y
encapsuladas en resina de poliuretano.
~ Clase térmica tw=130°C.
~ Envolvente de material termoplástico de Clase II.
~ Con conector antitracción de Clase II.
~ También se fabrican con protección térmica incorporada.
Para solicitar debe añadir la letra - P (Ejemp. VSI 7/23-C2-AI-P)
~ Bajo demanda se pueden fabricar de otras tensiones y frecuencias.
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
1
2
L
N
~
EN-61347-2-9
EN-60923
L
206
N
Lamp
www.elt.es
%QORCEVCUUGODNKGUHQTJKIJRTGUUWTGUQFKWOXCRQWTNCORU
%NCUU+++2*KIJRQYGTHCEVQT
Equipos completos para lámparas de vapor de sodio alta presión
Clase II IP54. Alto factor de potencia
A
A1
6,5 ±1
VSE-C2-AI
230V
50Hz
B
10
L1 LT
A2
525
9KVJ
thermal
RTQVGEVKQP
Con
protección
térmica
9KVJQWV
Power
Current
Current
thermal
RTQVGEVKQP Potencia Intensidad Intensidad
Sin
protección
térmica
W
A
A
Power
factor
Factor de
potencia
NJ
ta (°C)
B
L1 LT
A/A 2 A 1
mm mm mm mm mm
Homologaciones
Modelo
Índice
Model
Approvals
Línea
Index
Lámpara
Dimensiones
Supply
&KOGPUKQPU
Lamp
1RGTCVKPIVGOR
Ref. No.
Temp. funcionamiento
EQUIPMENTS WITH DIGITAL IGNITOR PULSE-PAUSE OPERATION (Max. load capacity: 2000pF)
CONJUNTOS CON ARRANCADOR DIGITAL TEMPORIZADO PULSO PAUSA (Capacidad max. admisible cable: 2000pF)
EEI
VSE 7/23-C2-AI
-
6210310
70
1,00
0,39
0,90 + 0,05
50
69/84
56
62
171
183
A3
01
VSE 10/23-C2-AI
6210612
6210610
100
1,20
0,55
0,90 + 0,05
50
69/84
56
62
171
183
A3
01
VSE 15/23-C2-AI
-
6210580
150
1,80
0,81
0,90 + 0,05
50
92/97
76
83
155
172
A3
01
VSE 25/23-C2-AI
6210591
6210590
250
3,00
1,31
0,90 + 0,05
50
92/97
76
83
175
192
A3
01
VSE 40/23-C2-AI
6210601
6210600
400
4,45
2,20
0,85
40
92/97
76
83
205
222
A2
01
~ IP54 equipment for outdoor use, comprising of a ballast, ignitor and
a power factor correction capacitor.
~ Ballasts vacuum impregnated with polyester resin and encapsulated
in polyurethane resin.
~ Thermal class tw=130°C.
~ Incorporated in Class II thermoplastic material casing.
~ Connection with double insulated cables, hose type.
~ Installed with wires downwards presenting IP54 protection index.
~ Also manufactured with incorporated thermal protection. To request
this add the letter-P (e.g. VSE 7/23-C2-AI-P).
~ Further voltages and frequencies can be manufactured upon
request.
~ Equipos Clase II IP54 para intemperie que incorporan reactancia,
arrancador y condensador de corrección de f. de p. Uso exterior.
~ Reactancias impregnadas al vacío en resina de poliéster y
encapsuladas en resina de poliuretano.
~ Clase térmica tw=130°C.
~ Envolvente de material termoplástico de Clase II.
~ Con conexiones por cables de doble aislamiento, tipo manguera.
~ Colocados con los cables hacia abajo presentan un índice de
protección IP54.
~ También se fabrican con protección térmica incorporada. Para
solicitar debe añadir la letra - P (Ejemp. VSE 7/23-C2-AI-P).
~ Bajo demanda se pueden fabricar de otras tensiones y frecuencias.
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
L
~
EN-61347-2-9
EN-60923
www.elt.es
N
207
NEGRO
Black
AZUL
Blue
MARRON
Brown
VSI-E
VMI
220V
50Hz
Ballasts for metal halide lamps
Reactancias para lámparas de halogenuros metálicos
B
A
6,5
L1
L2
Lamp
Ref. No.
Power
factor
Lámpara
ţV
Model
With
thermal
protection
Con
protección
térmica
Without
thermal
protection
Sin
protección
térmica
VSI 10/22-2
6112145
VSI 15/22-3T-E
6112315
Modelo
VMI 25/22-3
VSI 25/22-3T-E
VMI 40/22-2
VSI 40/22-3T-E
Wiring
diagram
Dimensions
Factor
de
potencia
Dimensiones
Index
Esquema
conexión
Índice
nº
EEI
Approvals
Homologaciones
Power
Potencia
Current
Intensidad
W
A
K
NJ
6112140
100
1,20
70
0,44
62
52
105
126
1-2
A3
01
6112330
150
1,80
75
0,40
87
73
96
115
1-2
A3
01
-
5112290
250
2,10
70
0,57
87
73
96
115
2-3
A2
01
6112653
6112650
250
3,00
65
0,40
87
73
116
135
1-2
A3
01
-
5112150
400
3,50
75
0,55
87
73
116
135
2-3
A2
01
6112666
6112660
400
4,00
75
0,46
87
73
146
165
1-2
A2
01
A
B
L1 L2
mm mm mm mm
~ Ballasts for built-in use.
~ Vacuum impregnated with polyester resin.
~ Thermal class tw=130°C.
~ Available with 2,5 mm2 and 4 mm2 screw connection for powers
of up to 100W and between 150 and 400W respectively.
~ Also manufactured with incorporated thermal protection.
To request this add the letter P to the end of each type
(e.g. VSI 25/22-3T-E-P).
~ Further voltages and frequencies can be manufactured upon
request.
~ Reactancias a incorporar.
~ Impregnadas al vacío en resina de poliéster.
~ Clase térmica tw=130°C.
~ Con bornera de conexión por tornillo, de 2,5 mm2 y 4 mm2 para
las potencias hasta 100W y entre 150 y 400W respectivamente.
~ También se fabrican con protección térmica incorporada.
2CTCUQNKEKVCTNCUCÌCFKTNCNGVTCŌ2CNſPCNFGECFCVKRQ
(Ejemplo: VSI 25/22-3T-E-P).
~ Bajo demanda se pueden fabricar de otras tensiones y
frecuencias.
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
2TQFWEVUGNGEVKQPQPYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
+IPKVQTUFCVCRCICPFQPYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
%CRCEKVQTFCVCRCICPFQPYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
Selección de producto en www.elt.es/productos/buscador_producto.html
Tabla arrancadores pág. 222 y www.elt.es/productos/buscador_producto.html
Tabla cond. pág. 231 y www.elt.es/productos/buscador_producto.html
1
L
R
3
2
C
EN-61347-2-9
EN-60923
Negro
(Black)
Azul
(Blue)
N
2
1
3
Rojo
(Red)
R
3
R
1
L
L
Rojo
Red
2
R LN
C
A
C
AH 002-D
AVS 100...
N
208
AVS - 400...
Azul
Blue
N
www.elt.es
Ballasts for metal halide lamps
Reactancias para lámparas de halogenuros metálicos
VSI-D
VMI
230V
50Hz
B
A
6,5
L1
L2
Lamp
Ref. No.
Power
factor
Lámpara
ţV
Model
With
thermal
protection
Con
protección
térmica
Without
thermal
protection
Sin
protección
térmica
VHI 3/23-3
6112563
VSI 7/22-3T-D
6112049
VSI 10/22-3T-B
Wiring
diagram
Dimensions
Factor
de
potencia
Dimensiones
Index
Esquema
conexión
Índice
nº
EEI
Approvals
Homologaciones
Power
Potencia
Current
Intensidad
W
A
K
NJ
6112562
35
0,53
55
0,38
62
52
85
106
2
A3
6112047
70
1,00
70
0,37
62
52
85
106
1-2
A3
01
6112182
6112180
100
1,20
70
0,42
62
52
105
126
1-2
A3
01
VSI 15/22-3T-D
6112470
6112340
150
1,80
75
0,40
87
73
96
115
1-2
A3
01
VMI 25/23-3
5112411
5112410
250
2,10
70
0,55
87
73
96
115
2-3
A2
01
VSI 25/22-3T-D
6112460
6112350
250
3,00
65
0,40
87
73
116
135
1-2
A3
01
VMI 40/23-3
5112425
5112424
400
3,50
70
0,50
87
73
116
135
2-3
A2
01
VSI 40/22-3T-D
6112363
6112360
400
4,00
80
0,42
87
73
146
165
1-2
A2
01
Modelo
A
B
L1 L2
mm mm mm mm
-
~ Ballasts for built-in use.
~ Vacuum impregnated with polyester resin.
~ Thermal class tw=130°C.
~ Available with 2,5 mm2 and 4 mm2 screw connection for powers
of up to 100W and between 150 and 400W respectively.
~ Also manufactured with incorporated thermal protection.
To request this add the letter P to the end of each type
(e.g. VSI 25/22-3T-D-P).
~ Further voltages and frequencies can be manufactured upon
request.
~ Reactancias a incorporar.
~ Impregnadas al vacío en resina de poliéster.
~ Clase térmica tw=130°C.
~ Con bornera de conexión por tornillo, de 2,5 mm2 y 4 mm2 para
las potencias hasta 100W y entre 150 y 400W respectivamente.
~ También se fabrican con protección térmica incorporada.
2CTCUQNKEKVCTNCUCÌCFKTNCNGVTCŌ2CNſPCNFGECFCVKRQ
(Ejemplo: VSI 25/22-3T-D-P).
~ Bajo demanda se pueden fabricar de otras tensiones y
frecuencias.
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
2TQFWEVUGNGEVKQPQPYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
+IPKVQTUFCVCRCICPFQPYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
%CRCEKVQTFCVCRCICPFQPYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
Selección de producto en www.elt.es/productos/buscador_producto.html
Tabla arrancadores pág. 222 y www.elt.es/productos/buscador_producto.html
Tabla cond. pág. 231 y www.elt.es/productos/buscador_producto.html
1
L
R
3
2
C
EN-61347-2-9
EN-60923
www.elt.es
Negro
(Black)
Azul
(Blue)
N
2
1
3
Rojo
(Red)
R
3
R
1
L
L
Rojo
Red
2
R LN
C
A
C
AH 002-D
AVS 100...
N
209
AVS - 400...
N
Azul
Blue
VSI-G
VMI
240V
50Hz
Ballasts for metal halide lamps
Reactancias para lámparas de halogenuros metálicos
B
A
6,5
L1
L2
Lamp
Ref. No.
Power
factor
Lámpara
ţV
Model
With
thermal
protection
Con
protección
térmica
Without
thermal
protection
Sin
protección
térmica
VHI 3/24-3
6112573
VHI 7/22-3T-G
6112623
VSI 10/22-3T-G
Wiring
diagram
Dimensions
Factor
de
potencia
Dimensiones
Index
Esquema
conexión
Índice
nº
EEI
Approvals
Homologaciones
Power
Potencia
Current
Intensidad
W
A
K
NJ
6112572
35
0,53
45
0,38
62
52
85
106
2
A3
6112622
70
1,00
70
0,37
62
52
85
106
1-2
A3
01
6111525
6111520
100
1,20
70
0,42
62
52
105
126
1-2
A3
01
VSI 15/22-3T-G
6111570
6111530
150
1,80
75
0,40
87
73
96
115
1-2
A3
01
VMI 25/24-3
5112251
5112250
250
2,10
70
0,53
87
73
96
115
2-3
A2
01
VSI 25/22-3T-G
6111541
6111540
250
3,00
65
0,40
87
73
116
135
1-2
A3
01
VMI 40/24-2
5112261
5112260
400
3,50
75
0,48
87
73
116
135
2-3
A2
01
VSI 40/22-3T-G
6111552
6111550
400
4,00
80
0,42
87
73
146
165
1-2
A2
01
Modelo
A
B
L1 L2
mm mm mm mm
-
~ Ballasts for built-in use.
~ Vacuum impregnated with polyester resin.
~ Thermal class tw=130°C.
~ Available with 2,5 mm2 and 4 mm2 screw connection for powers
of up to 100W and between 150 and 400W respectively.
~ Also manufactured with incorporated thermal protection.
To request this add the letter P to the end of each type
(e.g. VSI 25/22-3T-G-P).
~ Further voltages and frequencies can be manufactured upon
request.
~ Reactancias a incorporar.
~ Impregnadas al vacío en resina de poliéster.
~ Clase térmica tw=130°C.
~ Con bornera de conexión por tornillo, de 2,5 mm2 y 4 mm2 para
las potencias hasta 100W y entre 150 y 400W respectivamente.
~ También se fabrican con protección térmica incorporada.
2CTCUQNKEKVCTNCUCÌCFKTNCNGVTCŌ2CNſPCNFGECFCVKRQ
(Ejemplo: VSI 25/22-3T-G-P).
~ Bajo demanda se pueden fabricar de otras tensiones y
frecuencias.
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
2TQFWEVUGNGEVKQPQPYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
+IPKVQTUFCVCRCICPFQPYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
%CRCEKVQTFCVCRCICPFQPYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
Selección de producto en www.elt.es/productos/buscador_producto.html
Tabla arrancadores pág. 222 y www.elt.es/productos/buscador_producto.html
Tabla cond. pág. 231 y www.elt.es/productos/buscador_producto.html
1
L
R
3
2
C
EN-61347-2-9
EN-60923
Negro
(Black)
Azul
(Blue)
N
2
1
3
Rojo
(Red)
R
3
R
1
L
L
Rojo
Red
2
R LN
C
A
C
AH 002-D
AVS 100...
N
210
AVS - 400...
Azul
Blue
N
www.elt.es
Ballasts for metal halide lamps
Reactancias para lámparas de halogenuros metálicos
VSI-E6
VMI
220V
60Hz
B
A
6,5
L1
L2
Lamp
Power
factor
Lámpara
Model
Modelo
ţV
Ref. No.
Power
Potencia
Current
Intensidad
W
A
Factor de
potencia
K
Wiring
diagram
Dimensions
Dimensiones
A
mm
NJ
B
mm
L1
mm
Esquema
conexión
L2
mm
nº
VHI 3/22-6
6113980
35
0,53
55
0,36
62
52
85
106
2
VHI 7/22-3T-E6
6113675
70
1,00
65
0,38
62
52
85
106
1-2
VSI 10/22-2
6113860
100
1,20
70
0,44
62
52
105
126
1-2
VSI 15/22-3T-E6
6113590
150
1,80
70
0,42
87
73
96
115
1-2
VMI 25/22-3
5113780
250
2,10
70
0,60
87
73
96
115
2-3
VSI 25/22-3T-E6
6113601
250
3,00
65
0,42
87
73
116
135
1-2
VMI 40/22-26
5113670
400
3,50
75
0,52
87
73
116
135
2-3
VSI 40/22-3T-E6
6113610
400
4,00
70
0,45
87
73
146
165
1-2
~ Ballasts for built-in use.
~ Vacuum impregnated with polyester resin.
~ Thermal class tw=130°C.
~ Available with 2,5 mm2 and 4 mm2 screw connection for powers
of up to 100W and between 150 and 400W respectively.
~ Also manufactured with incorporated thermal protection.
To request this add the letter P to the end of each type
(e.g. VSI 25/22-3T-E6-P).
~ Further voltages and frequencies can be manufactured upon
request.
~ Reactancias a incorporar.
~ Impregnadas al vacío en resina de poliéster.
~ Clase térmica tw=130°C.
~ Con bornera de conexión por tornillo, de 2,5 mm2 y 4 mm2 para
las potencias hasta 100W y entre 150 y 400W respectivamente.
~ También se fabrican con protección térmica incorporada.
2CTCUQNKEKVCTNCUCÌCFKTNCNGVTCŌ2CNſPCNFGECFCVKRQ
(Ejemplo: VSI 25/22-3T-E6-P).
~ Bajo demanda se pueden fabricar de otras tensiones y
frecuencias.
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
2TQFWEVUGNGEVKQPQPYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
+IPKVQTUFCVCRCICPFQPYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
%CRCEKVQTFCVCRCICPFQPYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
Selección de producto en www.elt.es/productos/buscador_producto.html
Tabla arrancadores pág. 222 y www.elt.es/productos/buscador_producto.html
Tabla cond. pág. 231 y www.elt.es/productos/buscador_producto.html
1
L
R
3
2
C
EN-61347-2-9
EN-60923
www.elt.es
Negro
(Black)
Azul
(Blue)
N
2
1
3
Rojo
(Red)
R
3
R
1
L
L
Rojo
Red
2
R LN
C
A
C
AH 002-D
AVS 100...
N
211
AVS - 400...
N
Azul
Blue
50-60Hz
53
66
6,5
L1
L2
15
Lamp
Ref. No.
Voltage
Frecuency
Model
Modelo
6
9KVJ
9KVJQWV
thermal
thermal
RTQVGEVKQP RTQVGEVKQP
Con
Sin
protección protección
térmica
térmica
Power
factor
Lámpara
ţV
Tensión
Frecuencia
Power
Potencia
Current
Intensidad
&KOGPUKQPU
Factor
de
potencia
Dimensiones
9KTKPI
FKCITCO
Index
Esquema
conexión
Índice
Homologaciones
220-230-240V
$CNNCUVUHQTOGVCNJCNKFGNCORU4GFWEGFUGEVKQP
Reactancias para lámparas de halogenuros metálicos
Sección reducida
Approvals
VSI-SC
VMI-SC
V/Hz
W
A
K
NJ
L1
L2
nº
EEI
VSI 15/3TE-SC
6112501
6112500
220/50
150
1,80
70
0,42
114
135
1-3
A3
01
VSI 15/3TD-SC
6112490
6112491
230/50
150
1,80
70
0,40
114
135
1-3
A3
01
VSI 15/3TG-SC
6112505
6112504
240/50
150
1,80
70
0,39
114
135
1-3
A3
01
VSI 15/3TE6-SC
6113520
6113521
220/60
150
1,80
70
0,42
114
135
1-3
-
VMI 25/22-SC
-
5112682
220/50
250
2,10
75
0,57
114
135
1-2
A2
VMI 25/23-SC
5112681
5112680
230/50
250
2,10
75
0,55
114
135
1-2
A2
VMI 25/24-SC
-
5112683
240/50
250
2,10
80
0,53
114
135
1-2
A2
-
01
01
VSI 25/3TE-SC
-
6112216
220/50
250
3,00
75
0,42
149
170
1-3
A3
VSI 25/3TD-SC
6112221
6112215
230/50
250
3,00
75
0,40
149
170
1-3
A3
01
VSI 25/3TG-SC
6112222
6112217
240/50
250
3,00
80
0,39
149
170
1-3
A3
01
VSI 25/3TE6-SC
-
6113691
220/60
250
3,00
75
0,42
149
170
1-3
-
VMI 40/22-SC
-
5112202
220/50
400
3,40
85
0,56
149
170
1-2
A2
VMI 40/23-SC
-
5112200
230/50
400
3,40
85
0,54
149
170
1-2
A2
01
VMI 40/24-SC
-
5112201
240/50
400
3,40
95
0,52
149
170
1-2
A2
01
01
-
~ For built-in use.
~ Compactc size. Small dimensions. Suitable to be used where a low
cross-section ballasts is required.
~ Vacuum impregnated in polyester resin.
~ Thermal class tw=130°C.
~ Connections:
~ Push wire connection 1,5 mm2.
~ Screw connection 2,5 mm2.
~ Further voltages and frequencies can be manufactured upon
request.
~ These ballasts are also available with thermal protector. In such
case add “P” at the end.
(e.g.: VSI 15/3TD-SC-P).
~ Reactancia a incorporar.
~ Tamaño compacto. Dimensiones reducidas, Aptas para alojar en
espacios, proyectores, cajas y luminarias pequeñas.
~ Impregnadas al vacío en resina de poliéster.
~ Clase térmica tw=130°C.
~ Bornes:
~ Conexión rápida 1,5 mm2.
~ Conexión tornillo 2,5 mm2.
~ Bajo demanda se pueden fabricar para otras tensiones y
frecuencias.
~ Estas reactancias se fabrican con protección térmica. Para
UQNKEKVCTNQUCÌCFKTCNVKRQNCNGVTCő2ŒCNſPCN
(Ejem: VSI 15/3TD-SC-P).
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
2TQFWEVUGNGEVKQPQPYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
+IPKVQTUFCVCRCICPFQPYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
%CRCEKVQTFCVCRCICPFQPYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
Selección de producto en www.elt.es/productos/buscador_producto.html
Tabla arrancadores pág. 222 y www.elt.es/productos/buscador_producto.html
Tabla cond. pág. 231 y www.elt.es/productos/buscador_producto.html
1
3
R
R
1
L
L
L
R LN
C
AH 002-D
N
AVS - 400...
2
C
A
C
N
212
R
3
Rojo
Red
2
EN-61347-2-9
EN-60923
3
2
Negro
(Black)
Azul
(Blue)
Azul
Blue
1
Rojo
(Red)
AVS 100 -DP
N
www.elt.es
Ballasts for metal halide lamps. High powers
Reactancias para lámparas de halogenuros metálicos.
Altas potencias
VHI
230V
380-400V
400-415V
50Hz
B
A
6,5
106
L1
L2
Lamp
Supply
Load
Model
Modelo
Ref. No.
Tensión
de Red
Power
factor
Lámpara
Power
Current
Potencia Intensidad
Wiring
diagram
Dimensions
ţV
Factor de
potencia
Dimensiones
V
W
A
NJ
K
A
mm
B
mm
Index
Esquema
conexión
Índice
Approvals
Homologaciones
L1
mm
L2
mm
nº
EEI
VHI 100/23-3
6112262
230
1000
8,25
0,55
65
130
106,5
141
170
2-5
A2
01
VHI 100/23-4
6112265
230
1000
8,25
0,55
70
105
87
209+10
231
2-5
A2
01
VSI 100/3T-D
6112291
230
1000
9,50
0,47
65
105
87
209+10
231
1-2
A2
VHI 200/23-4
6112748
230
2000
16,50
0,55
70
130
106,5
211
240
2-5
A2
VHI 200/38-40-3
6112751
380/400
2000
8,80
0,62/0,59
65/70
130
106,5
191
220
3-4
A2
VHI 200/38-40-4
6112752
380/400
2000
10,30
0,53/0,50
75/80
130
106,5
191
220
3
A2
VHI 200/38-40-7
6112744
380/400
2000
10,3/11,3
0,49/0,47
80/85
130
106,5
211
240
3
A2
-
VHI 200/40-41-8
6112302
400/415
2000
12,20
0,44/0,42
90/95
130
106,5
211
240
3
A2
-
01
01
01
~ Ballasts for built-in use.
~ Vacuum impregnated with polyester resin.
~ Thermal class tw=130°C.
~ With 10 mm2 screw push wire connection.
~ Further voltages and frequencies can be manufactured upon
request.
~ Reactancias a incorporar.
~ Impregnadas al vacío en resina de poliéster.
~ Clase térmica tw=130°C.
~ Con bornera de conexión por tornillo de 10 mm2.
~ Bajo demanda se pueden fabricar de otras tensiones y frecuencias.
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
2TQFWEVUGNGEVKQPQPYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
+IPKVQTUFCVCRCICPFQPYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
%CRCEKVQTFCVCRCICPFQPYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
Selección de producto en www.elt.es/productos/buscador_producto.html
Tabla arrancadores pág. 222 y www.elt.es/productos/buscador_producto.html
Tabla cond. pág. 231 y www.elt.es/productos/buscador_producto.html
1
L
2
C
2
R
3
1
3
2
R LN
C
Azul
(Blue)
A
AVS 100...
N
N
R
R
R
3 - 4,5kV
L1
400V
L1
5
4
3
L
Rojo
Red
380V
R LN
Rojo
Red
C
EN-61347-2-9
EN-60923
www.elt.es
1
L
Rojo
(Red)
Negro
(Black)
R
C
AH 005/380-DP
AVS-2000/380
L2
L2
213
Azul
Blue
AH 002-D
N
Azul
Blue
VSE-VME
220-230V
50Hz
Encapsulated ballasts for metal halide lamps
Reactancias encapsuladas para lámparas de halogenuros metálicos
B
A
A
B
L2 L1
L2 L1
10
6,5
5,5
Formato 1
Formato 1
Formato 2
Formato 2
220V
Lamp
Power
factor
Lámpara
Model
Modelo
Ref. No.
Power
Current
Potencia Intensidad
Wiring
diagram
Dimensions
ţV
Factor de
potencia
Format
Dimensiones
Formato
A
B
L1 L2
mm mm mm mm
Index
Esquema
conexión
Índice
nº
EEI
VSE 7/22-3T-E
6110330
70
1,00
0,38
70
1
70
60,3
120
132
1-2
A3
VSE 10/22-EA
6110170
100
1,20
0,44
70
1
70
60,3
106
118
1-2
A3
VSE 15/22-3T-E
6110360
150
1,80
0,40
70
2
92
83
95
111
1-2
A3
VME 25/22-EA
5110370
250
2,10
0,57
70
2
92
83
95
111
2-3
A2
VSE 25/22-3T-E
6110350
250
3,00
0,40
70
2
92
83
115
131
1-2
A3
VME 40/22-EA
5110380
400
3,50
0,55
75
2
92
83
115
131
2-3
A2
VSE 40/22-3T-E
6110370
400
4,00
0,43
70
2
92
83
146
162
1-2
A2
W
A
NJ
K
230V
VSE 7/22-3T-D
6110340
70
1,00
0,37
70
1
70
60,3
120
132
1-2
A3
VSE 10/22-3T-B
6110173
100
1,20
0,42
70
1
70
60,3
106
118
1-2
A3
VSE 15/22-3T-D
6110390
150
1,80
0,40
70
2
92
83
95
111
1-2
A3
VME 25/23-EA
5110390
250
2,10
0,55
70
2
92
83
95
111
2-3
A2
VSE 25/22-3T-D
6110400
250
3,00
0,40
75
2
92
83
115
131
1-2
A3
VME 40/23-EA
5110400
400
3,50
0,50
75
2
92
83
115
131
2-3
A2
VSE 40/22-3T-D
6110410
400
4,00
0,42
75
2
92
83
146
162
1-2
A2
~ Ballasts for outdoor use.
~ Vacuum impregnated with polyester resin and encapsulated in
polyurethane resin.
~ Thermal class tw=130°C.
~ Casing made of thermoplastic material.
~ Available with 2,5 mm2 and 4 mm2 screw connection for powers
of up to 100W and between 150 and 400W respectively.
~ Also manufactured with incorporated thermal protection.
To request this add the letter P to the end of each type
(e.g. VSE 25/22-3T-D-P).
~ Further voltages and frequencies can be manufactured upon
request.
~ Reactancias para intemperie. Uso exterior.
~ Impregnadas al vacío en resina de poliéster y encapsuladas en
resina de poliuretano.
~ Clase térmica tw=130°C.
~ Envolvente de material termoplástico.
~ Con bornera de conexión por tornillo, de 2,5 mm2 y 4 mm2 para
las potencias hasta 100W y entre 150 y 400W respectivamente.
~ También se fabrican con protección térmica incorporada.
2CTCUQNKEKVCTNCUCÌCFKTŌ2CNſPCNFGECFCVKRQ
(Ejem.: VSE 25/22-3T-D-P).
~ Bajo demanda se pueden fabricar de otras tensiones y
frecuencias.
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
1
L
R
3
2
C
EN-61347-2-9
EN-60923
Negro
(Black)
Azul
(Blue)
N
2
1
3
Rojo
(Red)
R
3
R
1
L
L
Rojo
Red
2
R LN
C
A
C
AH 002-D
AVS 100...
N
214
AVS - 400...
Azul
Blue
N
www.elt.es
#UUGODNKGUHQTOGVCNJCNKFGNCORU
Equipos completos para lámparas de halogenuros metálicos
VSI-AF
VMI-AF
230V
50Hz
B
L1 L
2
A1
58
A2
6
Model
Modelo
Ref.
No.
Lamp
Supply
Lámpara
Línea
Power
Power
Current
Current
factor
Potencia Intensidad Intensidad Factor de
potencia
ţV
&KOGPUKQPU
Index
Dimensiones
Índice
Approvals
Homologaciones
W
A
A
NJ
K
B
L1 L2
A1 A2
mm mm mm mm mm
EEI
VSI 7/23-3AF-150
6212130
70
1,00
0,40
0,90
70
62
120
77
85
106
A3
(*)
01
VSI 10/23-2AF-150
6212140
100
1,20
0,55
0,90
70
62
120
77
105
126
A3
(*)
01
VSI 15/23-3AF-150
6212150
150
1,80
0,78
0,90
70
87
145
94
96
115
A3
(*)
01
VMI 25/23-3AF-002
5612563
250
2,10
1,27
0,90
70
87
145
94
96
115
A2
(*)
01
VSI 25/23-3AF-400
6212160
250
3,00
1,33
0,90
65
87
145
94
116
135
A3
(*)
01
400
3,50
2,00
0,90
75
87
145
94
116
135
A2
(*)
01
400
3,50
2,00
0,90
75
87
145
94
116
135
A2
(*)
01
VMI 40/23-2AF-002
VMI 40/23-2AF-400
6212180
~ Equipment with ballast, ignitor and power factor correction
capacitor to be built in.
~ Vacuum impregnated with polyester resin.
~ Thermal class tw=130°C.
~ Available with 2.5 mm2 and 4 mm2 screw connection for powers of
up to 100W, between 150 and 400W, respectively.
~ Availability of easy-to-uninstall components to relocate in
reduced spaces.
~ Also manufactured with incorporated thermal protection.
~ Further voltages and frequencies can be manufactured upon
request.
~ Equipos con reactancia, arrancador y condensador de
corrección del f. de p. para incorporar.
~ Reactancias impregnadas al vacío en resina de políester.
~ Clase térmica tw=130°C.
~ Con bornera de conexión por tornillo, de 2,5 y 4 mm2 para las
potencias hasta 100W y entre 150 y 400W respectivamente.
~ Disposición de los componentes fácilmente desmontable para
reubicar en espacios reducidos.
~ También se fabrican con protección térmica incorporada.
~ Bajo demanda se pueden fabricar en otras tensiones y
frecuencias.
* Certifed components by their own
%QORQPGPVGUEGTVKſECFQURQTUGRCTCFQ
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
L
EN-61347-2-9
EN-61347-2-1
EN-61048
EN-61923
EN-61927
EN-61049
www.elt.es
1
215
~
N
2
3
4
5
#UUGODNKGU#4%'HQTOGVCNJCNKFGNCORU
Equipos completos enchufables ARCE para lámparas
de halogenuros metálicos
B
B
L2
L2
L1
6
51
L1
5
6
A
6
61
5
7
6
A
Lámpara
Línea
Modelo
&KOGPUKQPU
ţV
Model
9KVJ
thermal
RTQVGEVKQP
Con
protección
térmica
Dimensiones
Power
factor
Factor de
potencia
9KVJQWV
Power
Current
Current
thermal
RTQVGEVKQP Potencia Intensidad Intensidad
Sin
protección
térmica
W
A
A
K
NJ
A
B
L1 L2
mm mm mm mm
Homologaciones
Supply
Approvals
Lamp
Index
Ref. No.
Índice
150 - 250 y 400W
Esquema conexión
35-70 y 100W
9KTKPIFKCITCO
VSI-ARCE
VHI-ARCE
230V
50Hz
EEI
VHI 3/23-ARCE-150
6212743
6212744
35
0,53
0,21
0,90 + 0,05
55
62
81
85
158
2
A3
VSI 7/23-ARCE-150
6212706
6212705
70
0,98
0,38
0,90 + 0,05
70
62
81
85
158
2
A3
01
VSI 10/23-ARCE-150
6212715
6212714
100
1,20
0,55
0,90 + 0,05
70
62
81
105
178
2
A3
01
VSI 15/23-ARCE-150
6212732
6212731
150
1,80
0,79
0,90 + 0,05
75
87
76
96
175
1
A3
01
VHI 25/23-ARCE-002
6212783
6212787
250
2,10
1,30
0,90 + 0,05
70
87
76
96
175
1
A2
01
6212782
250
2,10
1,30
0,90 + 0,05
70
87
76
96
175
1
A2
01
VHI 25/23-ARCE-400
-
VSI 25/23-ARCE-400
6212784
6212781
250
3
1,33
0,90 + 0,05
65
87
76
116
195
1
A3
01
VHI 40/23-ARCE-002
6212830
6212793
400
3,50
1,80
0,90 + 0,05
75
87
76
116
195
1
A2
01
VHI 40/23-ARCE-400
6212796
6212792
400
3,50
1,80
0,90 + 0,05
75
87
76
116
195
1
A2
01
~ Pluggable equipment with ballast and subset comprising of
ignitor and power factor correction capacitor for built-in use.
~ Vacuum impregnated with polyester resin.
~ Thermal class tw=130°C.
~ With 2.5 mm2 screw connection.
~ To ensure earth connection continuity, it is necessary to use the
EGPVTCNſZKPIRQKPVVQLQKPVVJGDCNNCUVCPFVJGRNWIICDNGUWDUGV
~ Also manufactured with incorporated thermal protection.
To request this add the letter P to the end of each type:
(e.g. VSI 15/23-ARCE-150-P):
~ Further voltages or frequencies can be manufactured upon
request.
~ Equipos con reactancia y subconjunto enchufable que incorpora
arrancador y condensador de corrección del f. de p. para
incorporar.
~ Reactancias impregnadas al vacío en resina de poliéster.
~ Clase térmica tw=130°C.
~ Con bornera de conexión por tornillo de 2,5 mm2.
~ Para asegurar la continuidad de la toma de tierra, indispensable
utilizar el anclaje central de unión entre reactancia y subconjunto
enchufable.
~ Para solicitar con protección térmica se debe añadir la letra –P
CNſPCN
(Ejemp. VSI 15/23 ARCE-150-P).
~ Bajo demanda se pueden fabricar de otras tensiones y frecuencias.
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
1
L
EN-61347-2-9
EN-60923
EN-60927
1
216
~
2
N
2
L
3
4
5
1
~
N
2
3
4
5
www.elt.es
%QORCEVCUUGODNKGUHQTOGVCNJCNKFGNCORU%NCUU+++2
Equipos completos para lámparas de halogenuros metálicos
IP40 Clase II
A
A1
6, 5 –1
VSI-C2-AI
VHI-C2-AI
230V
50Hz
Format 1
Formato 1
B
L
L2 TR
C2-AI
10
L1 LT
–10
300
Format 3
Formato 3
83
A2
Format 1
Formato 1
98,5
Format 3
Formato 3
Format 2
Formato 2
C2-AI CLEMA
6211510
VSI 7/23-C2-AI-CLEMA
EEI
69/84
56
62
171
183
-
-
1
A3
-
70
3
69/84
56
62
171
183
-
-
2
A3
-
0,90 + 0,05
55
1
69/84
56
62
171
183
-
-
1
A3
01
0,90 + 0,05
55
3
69/84
56
62
171
183
-
-
2
A3
01
ta
(°C)
35
0,53
0,22
0,90 + 0,05
70
35
0,53
0,22
0,90 + 0,05
70
1,00
0,39
70
1,00
0,39
Approvals
NJ
&KOGPUKQPU
A
Format
Formato
A
Homologaciones
nº
1
W
Dimensiones
Index
Índice
VSI 7/23-C2-AI
9KTKPIFKCITCO
Esquema conexión
VHI 3/23-C2-AI-CLEMA
A/A 2 A 1
B
L 1 L T L 2 L TR
mm mm mm mm mm mm mm
Power
factor
Factor de
potencia
6212651
Línea
Current
Intensidad
VHI 3/23-C2-AI
Ref.
No.
Lámpara
Current
Intensidad
Modelo
Supply
Power
Potencia
Model
Lamp
1RGTCVKPIVGOR
Temp. funcionamiento
EQUIPMENTS WITH PULSE-PAUSE DIGITAL IGNITOR OPERATION (Max. load capacity: 2000pF)
CONJUNTOS CON ARRANCADOR DIGITAL TEMPORIZADO PULSO-PAUSA (Capacidad max. admisible cable: 2000pF)
VSI 7/23-C2S-AI
6211520
70
1,00
0,39
0,90 + 0,05
60
2
69/84
56
62
-
-
106
118
1
A3
01
VSI 10/23-C2-AI
6212520
100
1,20
0,55
0,90 + 0,05
60
1
69/84
56
62
171
183
-
-
1
A3
01
100
1,20
0,55
0,90 + 0,05
60
3
69/84
56
62
171
183
-
-
2
A3
01
VSI 10/23-C2-AI-CLEMA
VSI 10/23-C2S-AI
6212530
100
1,20
0,55
0,90 + 0,05
60
2
69/84
56
62
-
-
106
118
1
A3
01
VSI 15/23-C2-AI
6212260
150
1,80
0,81
0,90 + 0,05
60
1
92/97
76
83
155
172
-
-
1
A3
01
VSI 15/23-C2S-AI
6212290
150
1,80
0,81
0,90 + 0,05
60
2
92/97
76
83
-
-
96
112
1
A3
01
(*)VHI 25/23-C2-AI
6212320
250
2,10
1,30
0,90 + 0,05
60
1
92/97
76
83
155
172
-
-
1
A2
01
(*)VHI 25/23-C2S-AI
6212330
250
2,10
1,30
0,90 + 0,05
60
2
92/97
76
83
-
-
96
112
1
A2
01
VSI 25/23-C2-AI
6212270
250
3,00
1,31
0,90 + 0,05
60
1
92/97
76
83
175
192
-
-
1
A3
01
VSI 25/23-C2S-AI
6212300
250
3,00
1,31
0,90 + 0,05
60
2
92/97
76
83
-
-
116
131
1
A3
01
(*)VHI 40/23-C2-AI
6212340
400
3,50
1,95
0,90 + 0,05
55
1
92/97
76
83
175
192
-
-
1
A2
01
(*)VHI 40/23-C2S-AI
6212350
400
3,50
1,95
0,90 + 0,05
55
2
92/97
76
83
-
-
116
131
1
A2
01
VSI 40/23-C2-AI
6212280
400
4,00
2,05
0,90 + 0,05
45
1
92/97
76
83
205
222
-
-
1
A2
01
VSI 40/23-C2S-AI
6212310
400
4,00
2,05
0,90 + 0,05
45
2
92/97
76
83
-
-
146
162
1
A2
01
~ Class II IP40 equipment comprising of ballast, intelligent digital
timing type ignitor (AI) and power factor correction capacitor.
~ Vacuum impregnated with polyester resin and encapsulated in
polyurethane resin.
~ Thermal class tw=130°C.
~ Incorporated in Class II thermoplastic material casing.
~ With Class II anti-traction connector.
~ Also manufactured with incorporated thermal protection.
~ Further voltages and frequencies can be manufactured upon
request.
(*) Ignitor Up=0,8Kv included
~ Equipos Clase II IP40 que incluyen reactancia, arrancador de tipo
inteligente digital temporizado (AI) y condensador de corrección de
f. de p.
~ Reactancias impregnadas al vacío en resina de poliéster y
encapsuladas en resina de poliuretano.
~ Clase térmica tw=130°C.
~ Incorporadas a un envolvente de material termoplástico de Clase II.
~ Con conector antitracción de Clase II.
~ También se fabrican con protección térmica incorporada.
~ Bajo demanda se pueden fabricar de otras tensiones y frecuencias.
(*) Incluyen arrancador Up= 0,8Kv
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
1
2
L
~
EN-61347-2-9
EN-60923
www.elt.es
L
217
N
Lamp
N
VHI-C2-SC-P
230V
Compact assemblies for metal halide lamps. Class II. IP40
Equipos completos para lámparas de halogenuros metálicos
Clase II. IP40
71,5
62
5,5
64,5
7,6
195207
70
IP40 ASSEMBLIES WITH CONNECTION TERMINALS / EQUIPOS IP40 CON BORNES DE CONEXIÓN
Ref. No.
Model
Modelo
With
thermal
protection
Con
protección
térmica
Lamp
Supply
Lámpara
Línea
Power
Potencia
Current
Intensidad
Current
Intensidad
Power factor
Factor de potencia
Operating temp.
Index
Temp.
funcionamiento
Índice
EEI
W
A
A
NJ
ta (°C)
VHI 3/23-C2-SC-P
-
35
0,53
0,22
0,90 + 0,05
70
A3
VHI 7/23-C2-SC-P
6211536
70
1,00
0,40
0,90 + 0,05
60
A3
VSI 10/23-C2-SC-P
-
100
1,20
0,55
0,90 + 0,05
60
A3
VSI 15/23-C2-SC-P
6212267
150
1,80
0,81
0,90 + 0,05
60
A3
~ Class II control gear, independent or built-in use:
~ Ballast with thermal protection and encapsulated in polyurethane
resin.
~ Digital pulse-pause ignitor and high power factor capacitor.
~ Thermal class tw=130°C.
~ Under request the type IP40 can be manufactured with hose and
connector WIELAND GST 18.
~ Further voltages and frequencies can be manufactured upon
request.
~ Equipos completos, independientes o a incorporar, Clase II que
incluyen:
~ Reactancia con protección térmica encapsulada en resina de
poliuretano.
~ Arrancador digital, técnica pulso-pausa y condensador para alto
factor de potencia.
~ Clase térmica tw=130°C.
~ Bajo demanda el modelo IP40 se suministra con manguera y
conector WIELAND GST 18.
~ También se fabrica para otras tensiones y frecuencias.
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
EN-61347-2-9
EN-60923
L
218
N
www.elt.es
%QORCEVCUUGODNKGUHQTOGVCNJCNKFGNCORU%NCUU+++2
Equipos completos para lámparas de halogenuros metálicos.
Clase II IP54
A
A1
6,5 ±1
VSE-C2-AI
230V
50Hz
B
10
L1 LT
A2
525
EQUIPMENTS WITH PULSE-PAUSE IGNITOR OPERATION (Max. load capacity: 2000pF)
CONJUNTOS CON ARRANCADOR INTELIGENTE DIGITAL TEMPORIZADO PULSO-PAUSA
(Capacidad max. admisible cable: 2000pF)
Model
Modelo
Ref.
No.
Lamp
Supply
Lámpara
Línea
1RGTCVKPI
temp.
Temp.
Power
funcionamiento
Power
Current
Current
factor
Potencia Intensidad Intensidad Factor de
potencia
&KOGPUKQPU
Index
Dimensiones
Índice
Approvals
Homologaciones
W
A
A
NJ
ta (°C)
A/A 2
mm
A1
B
L1 LT
mm mm mm mm
EEI
VHE 3/23-C2-AI
6210743
35
0,53
0,22
0,90 + 0,05
50
69/84
56
62
171
183
A3
VSE 7/23-C2-AI
6210310
70
1,00
0,39
0,90 + 0,05
50
69/84
56
62
171
183
A3
01
VSE 10/23-C2-AI
6210610
100
1,20
0,55
0,90 + 0,05
50
69/84
56
62
171
183
A3
01
VSE 15/23-C2-AI
6210580
150
1,80
0,81
0,90 + 0,05
50
92/97
76
83
155
172
A3
01
VHE 25/23-C2-AI
6210620
250
2,10
1,30
0,90 + 0,05
55
92/97
76
83
155
172
A2
01
VSE 25/23-C2-AI
6210590
250
3,00
1,31
0,90 + 0,05
50
92/97
76
83
175
192
A3
01
VHE 40/23-C2-AI
6210680
400
3,50
1,95
0,90 + 0,05
50
92/97
76
83
175
192
A2
01
VSE 40/23-C2-AI
6210600
400
4,00
2,05
0,90 + 0,05
40
92/97
76
83
205
222
A2
01
~ IP54 equipments for outdoor use, comprising of a ballast, ignitor
and a power factor correction capacitor.
~ Ballasts vacuum impregnated with polyester resin and
encapsulated in polyurethane resin.
~ Thermal class tw=130°C.
~ Incorporated in Class II thermoplastic material casing.
~ Connection with double insulated cables, hose type.
~ Installed with wires downwards presenting IP54 protection index.
~ Also manufactured with incorporated thermal protection or with
independent hose wires for mains and lamp.
~ Further voltages and frequencies can be manufactured upon
request.
~ Equipos Clase II IP54 para intemperie que incorporan
reactancia, arrancador (AI) y condensador de corrección del f.
de p. Uso exterior.
~ Reactancias impregnadas al vacío en resina de poliéster y
encapsuladas en resina de poliuretano.
~ Clase térmica tw=130°C.
~ Incorporadas a un envolvente de material termoplástico de
Clase II.
~ Con conexiones por cables de doble aislamiento, tipo manguera.
~ Colocados con los cables hacia abajo presentan un índice de
protección IP54.
~ También se fabrican con protección térmica incorporada o con
cables manguera independientes para red y lámpara.
~ Bajo demanda se pueden fabricar de otras tensiones y
frecuencias.
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
L
~
EN-61347-2-9
EN-60923
www.elt.es
N
219
NEGRO
Black
AZUL
Blue
MARRON
Brown
$CNNCUVUHQTOGVCNJCNKFGNCORUENCUU++JKIJRQYGTHCEVQT6YQJQUGU
Reactancias para lámparas de halogenuros metálicos
Clase II alto factor de potencia. Doble manguera
A
A1
6,5 –1
B
10
L1 LT
A2
250
Model
Modelo
Ref.
No.
Lamp
Supply
Lámpara
Línea
1RGTCVKPI
temp.
Temp.
Power
funcionamiento
Power
Current
Current
factor
Potencia Intensidad Intensidad Factor de
potencia
W
A
A
NJ
ta (°C)
&KOGPUKQPU
Index
Dimensiones
Índice
B
L1 LT
A/A 2 A 1
mm mm mm mm mm
Homologaciones
EQUIPEMENT WITH PULSE-PAUSE IGNITOR OPERATION (Max. load capacity: 2000pF)
CONJUNTOS CON ARRANCADOR INTELIGENTE DIGITAL TEMPORIZADO PULSO-PAUSA
(Capacidad max. admisible cable: 2000pF)
Approvals
VSE-C2
-AI-P
230V
50Hz
EEI
VHE 3/23-C2-AI-P 2 MANG
6210749
35
0,53
0,22
0,90 + 0,05
55
69/84
56
62
171
183
A3
01
VHE 7/23-C2-AI-P 2 MANG
6210153
70
1,00
0,39
0,90 + 0,05
50
69/84
56
62
171
183
A3
01
100
1,20
0,55
0,90 + 0,05
50
69/84
56
62
171
183
A3
01
150
1,80
0,81
0,90 + 0,05
50
92/97
76
83
155
172
A3
01
250
2,10
1,30
0,90 + 0,05
50
92/97
76
83
155
172
A2
01
VSE 10/23-C2-AI-P 2 MANG
VSE 15/23-C2-AI-P 2 MANG
6210811
VHE 25/23-C2-AI-P 2 MANG
VSE 25/23-C2-AI-P 2 MANG
250
3,00
1,30
0,90 + 0,05
50
92/97
76
83
175
192
A3
01
VHE 40/23-C2-AI-P 2 MANG
6210666
400
3,50
2,00
0,90 + 0,05
50
92/97
76
83
175
192
A2
01
VSE 40/23-C2-AI-P 2 MANG
400
4,00
2,05
0,90 + 0,05
40
92/97
76
83
205
222
A2
01
~ IP54 equipments for outdoor use, comprising of a ballast, ignitor
and a power factor correction capacitor.
~ Ballasts vacuum impregnated with polyester resin and
encapsulated in polyurethane resin.
~ Thermal class tw=130°C.
~ Class II thermoplastic material casing.
~ Connection with double insulated cables, hose type, independent
for mains and lamp.
~ With earth wire going through to luminaire.
~ With incorporated thermal protection.
~ Further voltages and frequencies can be manufactured upon
request.
~ Equipos Clase II IP54 para intemperie que incorporan reactancia,
arrancador y condensador de corrección del f. de p. Uso exterior.
~ Reactancias impregnadas al vacío en resina de poliéster y
encapsuladas en resina de poliuretano.
~ Clase térmica tw=130°C.
~ Envolvente de material termoplástico de Clase II.
~ Con conexiones por cables de doble aislamiento, tipo manguera,
independientes para red y lámpara.
~ Con conductor de tierra pasante para la red y luminaria.
~ Con protección térmica incorporada.
~ Bajo demanda se pueden fabricar de otras tensiones y
frecuencias.
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
L
Marrón / Brown
~ Azul / Blue
Marrón / Brown
Azul / Blue
N
Amarillo - Verde
Yellow- Green
EN-61347-2-9
EN-60923
220
Amarillo - Verde
Yellow- Green
www.elt.es
'NGEVTQOCIPGVKEEQPVTQNIGCTOGVCNJCNKFGNCORUOQWPVGFKP+2DQZ
Equipos completos en cofre IP65 para halogenuros metálicos
180
370
–5
290
–2
172 213
METAL HALIDE LAMPS / LAMPARAS HALOGENUROS METALICOS
Model
Modelo
Ref. No.
Lamp
Supply
Lámpara
Línea
Power
factor
Factor de
potencia
Condensador
AF
A
NJ
μF/V
Power
Potencia
Current
Intensidad
Voltage
Tensión
Current
Intensidad
W
A
V
9KTKPI
FKCITCO
%CRCEKVQT
for HPF
+IPKVQT
Index
Esquema Índice
conexión
Arrancador
nº
EEI
VHE 100/23-002-AF
6210327
1000
8,25
230
5
0,9 + 0,05
72/250
AH 002-D
1
A2
VHE 100/23-1000-AF
6210321
1000
9,50
230
5
0,9 + 0,05
85/250
AH 1000
1
A2
VHE 200/23-002-AF
6210306
2000
16,50
230
10,3
0,9 + 0,05
150/250
AH 002-D
1
A2
VHE 200/38-40-3AF
6210303
2000
8,80
380/400
6/5,8
0,9 + 0,05
37/400
-
2
A2
VHE 200/38-40-005-AF
6210302
2000
8,80
380/400
6/5,8
0,9 + 0,05
37/400
AH 005/380
3
A2
VHE 200/38-40-4AF
6210300
2000
10,30
380/400
6/5,8
0,9 + 0,05
60/400
-
2
A2
VHE 200/38-40-4-2000
6210304
2000
10,30
380/400
6/5,8
0,9 + 0,05
60/400
AVS 2000/380
4
A2
VHE 200/38-40-5-AF
6210305
2000
11,30
380/400
6/5,8
0,9 + 0,05
60/400
-
2
A2
VHE 200/38-40-5-AF-2000
6210292
2000
11,30
380/400
6/5,8
0,9 + 0,05
60/400
AVS 2000/380
4
A2
~ Assembly of ballast, independent type ignitor and power factor
correction capacitor. For outdoor use.
~ Thermal class tw=130°C.
~ All components incorporated in an aluminium box injected with
UGCNCPFUVWHſPIYJKEJRTQXKFGU+2RTQVGEVKQPKPFGZ
~ Further voltages and frequencies can be manufactured upon
request.
~ Montajes de reactancia, arrancador de tipo independiente y
condensador de corrección del f. de p. para intemperie. Uso
exterior.
~ Clase térmica tw=130°C.
~ Incorpora todos los componentes en una caja de aluminio
inyectado con juntas de estanqueidad y prensaestopas que le
EQPſGTGPWPÈPFKEGFGRTQVGEEKÎP+2
~ Bajo demanda se pueden fabricar de otras tensiones y
frecuencias.
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
L1
L2
L2
400V
4
380V
L1
221
400V
A
1,2kV
www.elt.es
400V
R L N
N
3
EN-61347-2-9
EN-60923
380V
L
2
380V
1
3,5-5kV
L1
L2
VHE-BOX
230V
380-400V
50Hz
+IPKVQTUGNGEVKQPVCDNG
Tabla para la selección de arrancadores
IGNITORS FOR HID LAMPS / ARRANCADORES PARA LÁMPARAS DE HID.
LPS Lamps
+IPKVQTV[RG
HPS Lamps
MH Lamps
Tipo de arrancador
Lámparas de vapor de sodio AP
Lámparas de halogenuros metálicos
W
AVS 100-D
AVS 100-DP
AVS 400-D
AVS 400-DP
50
70
Ŗ
Ŗ
Ŗ
Ŗ
100 150 250 400 600 1000
Ŗ(3)
Ŗ(3)
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
AVS 1000
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
AH 1000
35
50
70
100
150
250
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
Ŗ
400 1000
Ŗ
Ŗ
Ŗ
Ŗ
Lámparas
sodio BP
2000
2000
220
380
Ŗ
Ŗ
Ŗ
Ŗ
AVS 2000/380
Ŗ
AH 2000/220
Ŗ
Ŗ(1)
AH 005/380-DP
Ŗ
AH 002-D
(1)
Suitable for lamps with pulse
peak voltage 1,2Kv.
Para lámparas de tensión de
encendido 1,2Kv.
35
(2)
(3)
Suitable for lamps with pulse peak
voltage 0,8Kv.
Valido para lámparas de tensión
de encendido 0,8Kv.
(2)
Ŗ
(2)
Ŗ
(2)
Ŗ
Ŗ
(2)
For Na 70W lamps. Double
socket
Para lámparas Na 70W (DE).
Doble casquillo.
TECHNICAL INFORMATION ABOUT ELT IGNITORS / INFORMACIÓN TECNICA SOBRE LOS ARRANCADORES ELT
Model
Modelo
Ref. No.
Type
System
6GORQTK\CVKQP
%QPPGEVKQP
Tipo
Sistema
Temporización
Conexión
Power of the
lamps
Potencia de las
lámparas
&KUVCPEG
from the
lamp
Distancia a
lámpara
AVS 400-D
3210232
Independent
Independiente
Super-imposed
Superposición
NO
Screw / Tornillo
HPS 70 - 400W
HM 35 - 400W
Max
1,5 Mtrs
AVS 400-DP
3210233
Independent
Independiente
Super-imposed
Superposición
YES / SÍ 20’
Screw / Tornillo
HPS 70 - 400W
HM 35 - 400W
Max
1,5 Mtrs
#85&
%CDNGU
3210113
Dependent
Dependiente
Impulse transf.
Transf. de impulsos
NO
Cables / Cables
HPS 50 - 1000W
MH 100 - 1000W
Until / Hasta
10 Mtrs
AVS 100-D (Bornes) *
3210112
Dependent
Dependiente
Impulse transf.
Transf. de impulsos
NO
Screw / Tornillo
HPS 50 - 1000W
MH 100 - 1000W
Until / Hasta
10 Mtrs
#85&2
%CDNGU
3210111
Dependent
Dependiente
Pulse paused
Pulso pausa
YES / SÍ 30’
Cables / Cables
HPS 50 - 1000W
MH 35 - 1800W
Until / Hasta
20 Mtrs
AVS 100-DP (Bornes)
3210442
Dependent
Dependiente
Pulse paused
Pulso pausa
YES / SÍ 30’
Screw / Tornillo
HPS 50 - 1000W
MH 35 - 1800W
Until / Hasta
20 Mtrs
#85&2
%CDNGU
3211053
Dependent
Dependiente
Pulse paused
Pulso pausa
YES / SÍ 30’
Cables / Cables
HPS 50 - 1000W
MH 35 - 1800W
From / Desde
15 a/to 40 Mtrs
AVS 100-DP-40 (Bornes)
3211054
Dependent
Dependiente
Pulse paused
Pulso pausa
YES / SÍ 30’
Screw / Tornillo
HPS 50 - 1000W
MH 35 - 1800W
From / Desde
15 a/to 40 Mtrs
#*&8R-X
%CDNGU
3210132
Independent
Independiente
Parallel
connection
Conexión
paralelo
NO
Cables / Cables
MH 250 - 2000W
and SOX 35W
Until / Hasta
100 Mtrs
#*&8R-X
$QTPGU
3210131
Independent
Independiente
Parallel
connection
Conexión
paralelo
NO
Screw / Tornillo
MH 250 - 2000W
and SOX 35W
Until / Hasta
100 Mtrs
#*&28R-X
3210191
Independent
Independiente
Parallel
connection
Conexión
paralelo
YES / SÍ 30’
Cables / Cables
MH 2000W 380V
Until / Hasta
100 Mtrs
AVS 1000
3210211
Independent
Independiente
Super-imposed
Superposición
NO
Screw / Tornillo
HPS 400 - 1000W
Max
2 Mtrs
AH 1000
3210212
Independent
Independiente
Super-imposed
Superposición
NO
Screw / Tornillo
HPS 1000W
MH 1000W
Max
2 Mtrs
#858RM8
3210241
Independent
Independiente
Super-imposed
Superposición
NO
Screw / Tornillo
MH 2000W 380V
Max
2 Mtrs
#*8RM8
3210251
Independent
Independiente
Super-imposed
Superposición
NO
Screw / Tornillo
MH 1000 and
2000W 220V
Max
2 Mtrs
Independent and parallel cconnection: Can be installed with ELT ballasts and
ballasts from other brands with 2 or 3 taps.
Dependent : Must be installed with ELT ballasts with 3 taps.
* AVS 100-D canno’t be installed with VSI-SC range.
Independiente y de conexión en paralelo: Puede instalarse con reactancias
fabricadas por ELT o por otras marcas de 2 o 3 bornas.
Dependiente: Debe ser instalado con reactancias fabricadas por ELT de 3
bornas.
* AVS 100-D no puede ser instalado con gama VSI-SC.
222
www.elt.es
Ignitor for high pressure sodium vapour and metal halide lamps
Arrancador para lámparas de vapor de sodio A.P y
halogenuros metálicos
#85
220-240V
*\
Lamps / Lámparas: Na 70 (DE), 100, 150, 250 y 400 W
Hgl 35 - 400 W.
NO¶Z#
12
40,5
89
34
67
10
M8
Model
Modelo
Ref. No.
AVS 400-D
AVS 400-DP(*)
3210232
3210233
Na 70(DE) -100, 150, 250, 400 W
Hgl 35 - 400 W
Lamp
Lámpara
Switch-on voltage
Tensión de arranque
V
ŭ
Switch-off voltage
Tensión de desconexión
V
>170
Main voltage
Tensión de alimentación
V
Ò
Peak voltage
Tensión de pico
kV
Ò
Impulse width at
Ancho de impulso a
Pulse No. per cycle
Nº de impulsos por periodo
2,5kV - μsec.
Ů
Ů
N.º
Impulse position
Posición del impulso
°e
240-270
Load capacitance
Capacidad de carga
pF
150
Losses at 4,6A
Pérdidas propias a 4,6A
W
Max.temp. at tc point
Temp. máx. envolvente
tc (°C)
105
Minimum ambient temp.
Temp. ambiente mínima
ta (°C)
-30
Cut-out time
Temporización
Approvals
Homologaciones
@50Hz - min
ŏv
01
`+PFGRGPFGPVKIPKVQT5WRGTKORQUGFU[UVGO
`7PKXGTUCNWUGWRVQ#
`+PUWNCVKPIUGNHGZVKPIWKUJKPIECUKPIYKVJHCUVGPKPIUJCPM/
`6GTOKPCNDNQEMKPRQN[COKFGÒOO2.
`'PECRUWNCVGFKPRQN[WTGVJCPGTGUKP
~ Arrancador Independiente. Sistema superposición de impulsos.
~ Utilización universal hasta 4,6A.
~ Envolvente aislante autoextinguible con espiga metálica M-8.
~ Bornes de conexión de poliamida 0,75 ÷ 2,5 mm2.
~ Encapsulado en resina de poliuretano.
2CEMCIKPICPFYGKIJVRCICPFYYYGNVGURTQFWEVQURCEMCIKPIA'.6RFH
2TQFWEVUGNGEVKQPQPYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
+IPKVQTUFCVCRCICPFQPYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
Selección de producto en www.elt.es/productos/buscador_producto.html
Tabla arrancadores pág. 222 y www.elt.es/productos/buscador_producto.html
#85&22WNUGRCWUGFKIKVCNKIPKVQT
AVS 400-DP. Arrancador temporizado técnica pulso-pausa.
45”
45”
+PVGTXCNUKPVKOG
Intervalos de tiempo
(50Hz)
47 ” 47 ” 185 ”
232”
247”
262”
216”
160”
3
R
1
L
2
R LN
A
C
'0
'0
'0
www.elt.es
N
223
AVS - 400...
AVS 100
220-240V
50-60Hz
+IPKVQTHQTJKIJRTGUUWTGUQFKWOXCRQWTCPFOGVCNJCNKFGNCORU
Arrancador para lámparas de vapor de sodio A.P y
halogenuros metálicos
Lamps / Lámparas: Na 50 a 1000W
Hgl 35 a 1800W
Format 1
Formato 1
Blue / Azul
M8
31
Black / Negro
Red / Rojo
29
Format 2
Formato 2
8
55
68
9
240
±5
M8
31
29
55
68
9
NEW PULSE-PAUSE DIGITAL IGNITOR
NUEVO ARRANCADOR DEPENDIENTE DIGITAL TEMPORIZADO CON TECNICA PULSO-PAUSA
Model
Modelo
Ref. No.
AVS 100-D
AVS 100-DP*
3210113
3210111
3211053
(Format/Formato1)
(Format/Formato1)
(Format/Formato1)
(Format/Formato2)
(Format/Formato2)
(Format/Formato2)
3210112
3210442
Na 50 a 1000W
Hgl 100 a 1000W
(exc. 150W)
3211054
Na 50 a 1000W
Hgl 35 a 1800W
Lamp
Lámpara
5YKVEJQPXQNVCIG
Tensión de arranque
V
ŭ
5YKVEJQHHXQNVCIG
Tensión de desconexión
V
>160
/CKPXQNVCIG
Tensión de alimentación
V
220 ÷ 240
2GCMXQNVCIG
Tensión de pico
kV
1,8 ÷ 2,3
3÷4
+ORWNUGYKFVJCV
Ancho de impulso a
1,6-2,5kV μsec.
Ů
Pulse No. per cycle
Nº de impulsos por periodo
N.º
1
+ORWNUGRQUKVKQP
Posición del impulso
°e
80 ÷ 100
.QCFECRCEKVCPEG
Capacidad de carga
pF
Losses
Pérdidas propias
W
<1
/CZVGORCVVERQKPV
Temp.máx. envolvente
tc (°C)
90
/KPKOWOCODKGPVVGOR
Temp. ambiente mínima
ta (°C)
-30
%WVQWVVKOG
Temporización
Approvals
Homologaciones
@50Hz - min
AVS 100-DP-40*
1000
2000
1500 - 4000
-
30
-
01
~ Impulse transformer system.
~ Operate with ELT ballasts with an adequate outlet.
~ Insulting, self-extinguishing casing with M8 fastening shank.
~ 0.75 and 1 mm2, 0.45/0.7 and 0.6/1kV connections.
~ Available with double insulated wires upon request.
~ Sistema transformador de impulsos.
~ Funciona con reactancias ELT con toma intermedia adecuada.
~ Envolvente aislante autoextinguible con espiga metálica M-8.
~ Conexiones 0,75 y 1 mm2, 0,45/0,7 y 0,6/1 kV.
~ Disponible bajo pedido, con cables de doble aislamiento.
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
2TQFWEVUGNGEVKQPQPYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
+IPKVQTUFCVCRCICPFQPYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
Selección de producto en www.elt.es/productos/buscador_producto.html
Tabla arrancadores pág. 222 y www.elt.es/productos/buscador_producto.html
(*) AVS 100-DP / AVS 100-DP-40. Pulse-pause digital ignitor.
AVS 100-DP / AVS 100-DP-40. Arrancador temporizado técnica pulso-pausa.
15”
Intervals in time
Intervalos de tiempo
(50Hz)
15”
ON
OFF
75” 75”
220”
260”
260”
260”
260”
R
3
L
260”
Rojo
Red
2
C
EN-61347-2-1
EN-60927
1
Negro
Black
Azul
Blue
AVS-100 ..
N
224
www.elt.es
+IPKVQTHQTNQYRTGUUWTGUQFKWOCPFOGVCNJCNKFGNCORUM8
Arrancador para lámparas de sodio B.P. y halogenuros
metálicos de 0,8 kV
Lamps / Lámparas: Na B.P. 35W
Hgl 250...2000W.
Vp = 0,8kV
Format 1
M8
Formato 1
31
AH 002
220-240V
50-60Hz
Blue / Azul
Black / Negro
Red / Rojo
29
Format 2
Formato 2
9
8
55
68
240
±5
M8
31
29
Model
9
55
68
Modelo
AH 002-D
3210132
(Format/Formato 1)
Ref. No.
3210131
(Format/Formato 2)
Na B.P. 35W
Hgl 250...2000W.
Vp = 0,8kV
Lamp
Lámpara
5YKVEJQPXQNVCIG
Tensión de arranque
V
ŭ
5YKVEJQHHXQNVCIG
Tensión de desconexión
V
>170
/CKPXQNVCIG
Tensión de alimentación
V
198 ÷ 264
2GCMXQNVCIG
Tensión de pico
kV
0,9
+ORWNUGYKFVJCV
Ancho de impulso a
0,6kV - μsec.
800
Pulse No. per cycle
Nº de impulsos por periodo
N.º
1
+ORWNUGRQUKVKQP
Posición del impulso
°e
80 ÷ 110
.QCFECRCEKVCPEG
Capacidad de carga
pF
10000
Losses
Pérdidas propias
W
<1
/CZVGORCVVERQKPV
Temp.máx. envolvente
tc (°C)
90
/KPKOWOCODKGPVVGOR
Temp. ambiente mínima
ta (°C)
-30
Approvals
Homologaciones
01
~ Independent ignitor with two wires. Parallel connection.
~ Insulating self-extinguishing casing with M8 fastening shank.
~ 0.75 mm2ƀGZKDNGEQPPGEVKQPU
~ Suitable for metal halide lamps with 0.8kV ignition voltage.
~ Available with double insulated wires upon request.
~ Arrancador independiente de dos hilos. Conexión paralelo.
~ Envolvente aislante autoextinguible con espiga metálica M-8.
~ Conexiones 0,75 mm2ƀGZKDNGU
~ Utilizable con lámparas de halogenuros metálicos con tensión de
encendido 0,8 kV.
~ Disponible bajo pedido, con cables de doble aislamiento.
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
2TQFWEVUGNGEVKQPQPYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
+IPKVQTUFCVCRCICPFQPYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
Selección de producto en www.elt.es/productos/buscador_producto.html
Tabla arrancadores pág. 222 y www.elt.es/productos/buscador_producto.html
R
R
L
L
Rojo
Red
Rojo
Red
C
C
EN-61347-2-1
EN-60927
www.elt.es
AH 002-D
N
Azul
Blue
AH 002-D
N
225
Azul
Blue
+IPKVQTHQTOGVCNJCNKFGNCORUM8
Arrancador para lámparas de halogenuros metálicos - 1,2 kV
240 ±5
48,5
Red / Rojo
Lamps / Lámparas: Hgl 2000W/400V
Vp=1,2 Kv
Blue / Azul
AH 005
380-415V
50-60Hz
8
40,5
34
47,5
10
M8
Model
Modelo
AH 005/380-DP
Lamp
Lámpara
Hgl 2000W/400V
Vp=1,2 Kv
5YKVEJQPXQNVCIG
Tensión de arranque
V
ŭ
5YKVEJQHHXQNVCIG
Tensión de desconexión
V
>300
/CKPXQNVCIG
Tensión de alimentación
V
342 ÷ 440
2GCMXQNVCIG
Tensión de pico
kV
1,2
+ORWNUGYKFVJCV
Ancho de impulso a
1kV - μsec.
>130
Pulse No. per cycle
Nº de impulsos por periodo
N.º
1
+ORWNUGRQUKVKQP
Posición del impulso
°e
80 ÷ 110
.QCFECRCEKVCPEG
Capacidad de carga
pF
10.000
Losses
Pérdidas propias
W
1
/CZVGORCVVERQKPV
Temp.máx. envolvente
tc (°C)
90
/KPKOWOCODKGPVVGOR
Temp. ambiente mínina
ta (°C)
-30
%WVQWVVKOG
Temporización
@50Hz - min
30
Ref. No.
3210191
~ Independent ignitor with two wires. Parallel connection.
~ Insulating self-extinguishing casing with fastening shank M-8.
~ Flexible connections 0,75 mm2.
~ Suitable for lamps with 1,2 kV ignition voltage.
~ Arrancador independiente de dos hilos. Conexión paralelo.
~ Envolvente aislante autoextinguible con espiga metálica M-8.
~ Conexiones 0,75 mm2ƀGZKDNGU
~ Utilizable con lámparas de tensión de encendido 1,2 kV.
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
2TQFWEVUGNGEVKQPQPYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
+IPKVQTUFCVCRCICPFQPYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
Selección de producto en www.elt.es/productos/buscador_producto.html
Tabla arrancadores pág. 222 y www.elt.es/productos/buscador_producto.html
15”
15”
ON
Intervals in time
Intervalos de tiempo
(50Hz)
OFF
75” 75”
220”
260”
260”
260”
260”
260”
R
L1
Rojo
Red
C
AH 005/380-DP
EN-61347-2-1
EN-60927
Azul
Blue
L2
226
www.elt.es
+IPKVQTHQTJKIJRTGUUWTGUQFKWOCPFOGVCNJCNKFG
Arrancador para lámparas de vapor de sodio A.P. y
halogenuros metalicos
AVS 1000 AH
1000
220-240
50-60Hz
Lamps / Lámparas: Na 400-600 y 1000W
Hgl 1000W
l máx. 12A
14
48
96 72
41,5
10
M8
Model
Modelo
AVS 1000
Ref. No.
AH 1000
3210211
3210212
Na 400, 600 y 1000W
Na 1000W
Hgl 1000W
Lamp
Lámpara
5YKVEJQPXQNVCIG
Tensión de arranque
V
ŭ
5YKVEJQHHXQNVCIG
Tensión de desconexión
V
>170
/CKPXQNVCIG
Tensión de alimentación
V
198 ÷ 264
2GCMXQNVCIG
Tensión de pico
kV
4÷5
+ORWNUGYKFVJCV
Ancho de impulso a
2,5kV - μsec.
Ů
Pulse No. per cycle
Nº de impulsos por periodo
N.º
4
2
+ORWNUGRQUKVKQP
Posición del impulso
°e
60-90
240-270
.QCFECRCEKVCPEG
Capacidad de carga
pF
200
Losses at 12A
Pérdidas propias a 12A
W
6
/CZVGORCVVERQKPV
Temp.máx. envolvente
tc (°C)
105
/KPKOWOCODKGPVVGOR
Temp. ambiente mínima
ta (°C)
-30
Approvals
Homologaciones
01
~ Independent ignitor. Superimposed system.
~ Universal use up to 12A.
~ Insulating self-extinguishing casing with fastening shank M-8.
~ Terminal block in polyamide 0,75 ÷ 2,5 mm2.
~ Encapsulated in polyurethane resin.
~ Arrancador independiente. Sistema superposición de impulsos.
~ Utilización universal hasta 12A.
~ Envolvente aislante autoextinguible con espiga metálica M-8.
~ Bornes de conexion de poliamida 0,75 ÷ 2,5 mm2.
~ Encapsulado en resina de poliuretano.
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
2TQFWEVUGNGEVKQPQPYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
+IPKVQTUFCVCRCICPFQPYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
Selección de producto en www.elt.es/productos/buscador_producto.html
Tabla arrancadores pág. 222 y www.elt.es/productos/buscador_producto.html
3
R
1
L
2
R LN
C
EN-61347-2-1
EN-60927
EN-60662
www.elt.es
N
227
A
AVS 2000
380-400V
50-60Hz
+IPKVQTHQTOGVCNJCNKFGNCORU
Arrancador para lámparas de halogenuros metálicos
Lamps / Lámparas: Hgl 2000W / 380V
l máx. 12A
14
48
96 72
41,5
10
M8
Model
Modelo
AVS 2000/380
Ref. No.
3210241
Hgl 2000W / 380V
l máx. 12A
Lamp
Lámpara
5YKVEJQPXQNVCIG
Tensión de arranque
V
ŭ
5YKVEJQHHXQNVCIG
Tensión de desconexión
V
>300
/CKPXQNVCIG
Tensión de alimentación
V
340 ÷ 456
2GCMXQNVCIG
Tensión de pico
kV
3,5 ÷ 5
+ORWNUGYKFVJCV
Ancho de impulso a
2,5kV - μsec.
Ů
Pulse No. per cycle
Nº de impulsos por periodo
N.º
2
+ORWNUGRQUKVKQP
Posición del impulso
°e
60-90
240-270
.QCFECRCEKVCPEG
Capacidad de carga
pF
200
Losses at 12A
Pérdidas propias a 12A
W
5
/CZVGORCVVERQKPV
Temp.máx. envolvente
tc (°C)
105
/KPKOWOCODKGPVVGOR
Temp. ambiente mínima
ta (°C)
-30
Approvals
Homologaciones
01
~ Independent ignitor. Superimposed system.
~ Universal use up to 12A.
~ Insulating self-extinguishing casing with fastening shank M-8.
~ Terminal block in polyamide 0,75 ÷ 2,5 mm2.
~ Encapsulated in polyurethane resin.
~ Arrancador independiente. Sistema superposición de impulsos.
~ Utilización universal hasta 12A.
~ Envolvente aislante autoextinguible con espiga metálica M-8.
~ Bornes de conexión de poliamida 0,75 ÷ 2,5 mm2.
~ Encapsulado en resina de poliuretano.
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
2TQFWEVUGNGEVKQPQPYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
+IPKVQTUFCVCRCICPFQPYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
Selección de producto en www.elt.es/productos/buscador_producto.html
Tabla arrancadores pág. 222 y www.elt.es/productos/buscador_producto.html
3
R
1
L1
2
R LN
C
EN-61347-2-1
EN-60927
A
L2
228
www.elt.es
AH 2000
220-240V
50-60Hz
Ignitor for metal halide lamps
Arrancador para lámparas de halogenuros metálicos
Lamps / Lámparas: Hgl 1000-2000W / 220V
l máx. 18A
62
Ø 5,5
55,5 68,5
106
118
Model
Modelo
AH 2000/220
Ref. No.
3210251
Hgl 1000-2000W / 220V
l máx. 18A
Lamp
Lámpara
5YKVEJQPXQNVCIG
Tensión de arranque
V
ŭ
5YKVEJQHHXQNVCIG
Tensión de desconexión
V
>170
/CKPXQNVCIG
Tensión de alimentación
V
198 ÷ 264
2GCMXQNVCIG
Tensión de pico
kV
3,5 ÷ 5
+ORWNUGYKFVJCV
Ancho de impulso a
2,5kV - μsec.
Ů
Pulse No. per cycle
Nº de impulsos por periodo
N.º
4
+ORWNUGRQUKVKQP
Posición del impulso
°e
70-90
250-270
.QCFECRCEKVCPEG
Capacidad de carga
pF
250
Losses at 18A
Pérdidas propias a 18A
W
10
/CZVGORCVVERQKPV
Temp.máx. envolvente
tc (°C)
90
/KPKOWOCODKGPVVGOR
Temp. ambiente mínima
ta (°C)
-30
~ Independent ignitor. Superimposed system.
~ Universal use up to 18A.
~ Thermoplastic material casing.
~ Terminal block in polyamide 1,5 ÷ 4 mm2.
~ Encapsulated in polyurethane resin.
~ Arrancador independiente. Sistema superposición de impulsos.
~ Utilización universal hasta 18A.
~ Envolvente de material termoplastico
~ Bornes de conexion de poliamida 1,5 ÷ 4 mm2.
~ Encapsulado en resina de poliuretano.
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
2TQFWEVUGNGEVKQPQPYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
+IPKVQTUFCVCRCICPFQPYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
Selección de producto en www.elt.es/productos/buscador_producto.html
Tabla arrancadores pág. 222 y www.elt.es/productos/buscador_producto.html
3
R
1
L
2
R LN
C
EN-61347-2-1
EN-60927
www.elt.es
N
229
A
Capacitors for power factor correction.
Characteristics and dimensions
Condensadores para correción del factor de potencia.
Características y dimensiones
6[RGQHECRCEKVQT
Ref. No.
8+-1
±5
200
9GKIVJ
Peso
7PKVURGT
DQZ
%CRCEKV[
Capacidad
Tolerance
Tolerancia
Voltage
Tensión
μF
v
V
Ø max
mm
l max
mm
Kg
9900002
2
5
250
25
62
0,035
9900004
2,5
5
250
25
62
0,035
180
9900007
4
5
250
25
62
0,035
180
9900802
9900008
4,5
5
250
25
62
0,035
180
9900803
9900009
5
5
250
25
75
0,040
180
Fast
OQWPVKPI
Fijación
rápida
M8
9900812
9900813
9900814
Unidades
por caja
180
9900804
9900010
5,5
5
250
25
75
0,040
180
9900815
9900011
6
5
250
30
75
0,040
140
9900805
9900012
7
5
250
30
75
0,045
140
9900816
9900013
8
5
250
30
75
0,045
140
9900806
9900014
9
5
250
30
75
0,045
140
9900807
9900015
10
5
250
30
75
0,055
140
9900817
9900016
11
5
250
35
75
0,060
100
9900818
9900017
12
5
250
35
75
0,060
100
9900819
9900018
13
5
250
35
75
0,060
100
9900808
9900019
14
5
250
35
75
0,065
100
9900809
9900020
16
5
250
35
75
0,075
100
9900810
9900021
18
5
250
40
75
0,075
60
9900811
9900022
20
5
250
35
100
0,080
60
9900023
22
5
250
40
100
0,090
60
20
L máx
22
&KOGPUKQPU
Dimensiones
Tipo de condensador
10
M8
D máx
9900024
25
5
250
40
100
0,090
60
9900025
28
5
250
40
100
0,090
60
9900026
30
5
250
40
100
0,105
60
9900027
32
5
250
40
100
0,110
60
9900028
36
5
250
40
100
0,125
60
9900030
45
5
250
45
100
0,140
32
9900031
50
5
250
50
100
0,170
28
9901250
30
5
440
45
132
0,270
25
9901237
37
5
440
50
132
0,300
25
9901627
45
5
440
50
132
0,310
25
9901602
2,9
4
420
36
80
0,045
100
9901607
3,6
4
420
36
80
0,045
100
9901613
5,7
4
420
40
80
0,060
50
APPLICATIONS
To correct the power factor in lighting equipment with
ƀWQTGUEGPVCPFFKUEJCTIGNCORU
TECHNICAL CHARACTERISTICS
Voltage:
250 and 400/440V (P. connection)
420V (Series connection)
Frequency: 50/60Hz
Capacity:
VQNGTCPEGU
v
2EQPPGEVKQP
v
5GTKGUEQPPGEVKQP
Operation
temperature:
-25 to +85°C
APLICACIONES
Para corregir el factor de potencia en equipos de alumbrado con
N¶ORCTCUƀWQTGUEGPVGU[FGFGUECTIC
CARACTERÍSTICAS TÉCNICAS
Tensión:
250 y 400/440V (Conexión en paralelo)
420V (Conexión en serie)
Frecuencia:
50/60Hz
Tolerancias
de capacidad: ±5% (Conexión en paralelo)
±4% (Conexión en serie)
Temp. de
funcionamiento:-25 +85°C
CONSTRUCTION FEATURES
Self-healing capacitors manufactured with metallized
polypropylene dielectric, incorporating discharge resistence.
Self-extinguishing plastic or metal cylindrical casing.
Polyurethane resin-encapsulated from 250V. Connection with 0,75 or
1 mm2 solid copper wire, depending on capacity.
CARACTERÍSTICAS CONSTRUCTIVAS
Condensadores autorregenerados fabricados con dieléctrico de
polipropileno metalizado, incorporan resistencia de descarga.
'PXQNXGPVGEKNÈPFTKECOGV¶NKEC
8QRN¶UVKECCWVQGZVKPIWKDNG
(<250V). Encapsulado en resina de poliuretano a partir de 250V.
Conexiones con hilo rígido de cobre de 0,75 o 1 mm2,
según capacidades.
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
2TQFWEVUGNGEVKQPQPYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
+IPKVQTUFCVCRCICPFQPYYYGNVGURTQFWEVQURTQFWEVAſPFGTJVON
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
Selección de producto en www.elt.es/productos/buscador_producto.html
Tabla arrancadores pág. 222 y www.elt.es/productos/buscador_producto.html
230
www.elt.es
Capacities for power factor correction
Capacidades para corregir el factor de potencia
Lamp
(QTECRCEKV[NJ
Voltage
Tensión
Lámpara
Capacidad para NJ
0,90 ±0,05
Type
Power
Potencia
Current
Intensidad
Tipo
W
A
V
50Hz
z(v
60Hz
z(v
50
0,61
220/230/240
7
6
Mercury vapour lamps
Vapor de mercurio
80
0,80
220/230/240
8
7
125
1,15
220/230/240
10
9
250
2,13
220/230/240
18
15
400
3,25
220/230/240
28
24
700
5,40
220/230/240
45
40
1000
7,50
220/230/240
60
50
50
0,76
220/230/240
9
7,5
70
1
220/230/240
12
10
100
1,20
220/230/240
13
11
*KIJRTGUUWTGUQFKWOXCRQWTNCORU
150
1,80
220/230/240
20
17
Vapor de sodio AP
250
3
220/230/240
32
28
400
4,45
220/230/240
45
40
600
6,20
220/230/240
65
55
1000
10,30
220/230/240
100
85
35
0,53
220/230/240
6
5
70
1
220/230/240
12
10
100
1,10
220/230/240
13
11
150
1,80
220/230/240
20
17
250
2,10
220/230/240
18
15
250
3
220/230/240
32
28
/GVCNJCNKFGNCORU
400
3,50
220/230/240
36
30
Halogenuros metálicos
1000
8,25
220/230/240
72
60
1000
9,50
220/230/240
90
75
2000
16,50
220/230/240
150
125
2000
8,80
380/400/415
37
32
2000
10,30
380/400/415
60
50
2000
11,30
380/400/415
60
50
2000
12,2
380/400/415
74
60
www.elt.es
231
Discharge lamps
Lámparas de descarga
Lamp type
Cap
Tipo de lámpara
Casquillo
HG
ILCOS
Reference
Siglas
ILCOS
Power
Lamp voltage
Current
Potencia
Tensión de lámpara
Intesidad
W
V
A
High pressure mercury vapour lamps
Lámparas de vapor de mercurio a alta presión
50
95
0,61
&GUETKRVKQP
Descripción
Q
E-27
QG
E-27
QR
High pressure mercury vapour lamps
Lámparas de vapor de mercurio a alta presión
80
125
115
125
0,80
1,15
E-40
QR
High pressure mercury vapour lamps
Lámparas de vapor de mercurio a alta presión
250
130
2,13
400
135
3,25
E-40
QE / QC
High pressure mercury vapour lamps
Lámparas de vapor de mercurio a alta presión
700
140
5,40
E-40
QE / QC
High pressure mercury vapour lamps
Lámparas de vapor de mercurio a alta presión
1000
145
7,50
High pressure sodium vapour lamps
Lámparas de vapor de sodio a alta presión
50
70
100
90
90
100
0,76
1,00
1,20
SAP/Na-H
S
RX 7s
SD
Fc-2
SD
High pressure sodium vapour lamps
Lámparas de vapor de sodio a alta presión
150
250
400
100
100
105/100
1,80
3,00
4,45/4,60
E-40
ST
High pressure sodium vapour lamps
Lámparas de vapor de sodio a alta presión
600
1000
105
110
6,20
10,30
E-27
SE / SC
White sodium vapour lamps
Lámparas de vapor de sodio blanco
SDW 35
SDW 50
SDW 100
96
92
98
0,48
0,76
1,30
E-40
SE / SC
White sodium vapour lamps
Lámparas de vapor de sodio blanco
SDX 50
SDX 100
SDX 150
45
80
100
1,32
1,53
1,90
PG-12
ST
White sodium vapour lamps
Lámparas de vapor de sodio blanco
SDX 250
SDX 400
100
100
3,10
4,70
Metal halide lamps
Lámparas de halogenuros metálicos
35
95
0,53
MH/HGL
M
G-12
MT
PG-12
MT
Metal halide lamps
Lámparas de halogenuros metálicos
70
95
0,98
RX 7s
MD
Metal halide lamps
Lámparas de halogenuros metálicos
100
95
1,15
Fc-2
MD
Metal halide lamps
Lámparas de halogenuros metálicos
150
100
1,80
E-40
MT
Metal halide lamps
Lámparas de halogenuros metálicos
175
250
95
100
1,50
3,00
E-40
MT
Metal halide lamps
Lámparas de halogenuros metálicos
250
400
125
125
2,10
3,40
E-40
MT
Metal halide lamps
Lámparas de halogenuros metálicos
400
121
4,00
E-40
ME / MC
Metal halide lamps
Lámparas de halogenuros metálicos
1000
120
9,50
E-40
ME / MC
Metal halide lamps
Lámparas de halogenuros metálicos
2000/220
2000/380
135
245
16,50
8,8/10,3/11,3
18
35
55
90
135
180
57
70
109
112
164
245
0,35
0,60
0,59
0,94
0,95
0,91
L
SBP
BY 22d
LS / LSE
Low pressure sodium vapour lamps
Lámparas de vapor de sodio baja presión
232
www.elt.es
Tecnical information
Información Técnica
$CNNCUVUHQTFKUEJCTIGNCORU
Reactancias para lámparas de descarga
*KIJKPVGPUKV[FKUEJCTIGNCORU
*+&
Lámparas de alta intensidad de descarga (HID)
These are lamps which have a gas discharge tube with
OWEJ UOCNNGT FKOGPUKQPU VJCP ƀWQTGUEGPV NCORU YJKEJ
YQTMCVUWHſEKGPVEWTTGPVFGPUKVKGUCPFRTGUUWTGUVQRTQFWEG
the visible radiation desired. Their evolution and broad applications is due to three main reasons:
Son aquellas que tienen un tubo de descarga gaseosa de
FKOGPUKQPGUOWEJQO¶UTGFWEKFCUSWGNCUN¶ORCTCƀWQTGUcentes, que trabajan a presiones y densidades de corriente
UWſEKGPVGURCTCRTQFWEKTNCTCFKCEKÎPXKUKDNGFGUGCFC5WGXQlución y amplia aplicación se debe a tres razones principales:
`*KIJ NWOKPQWU GHſEKGPE[ )TGCV COQWPV QH NWOGPU RGT
watt of power consumed.
~ They provide a compact source of light, which permits
IQQFEQPVTQNQHVJGNKIJVYKVJVJGWUGQHUWKVCDNGTGƀGEVQT
systems.
`.QPI NKHG CPF DGVVGT OCKPVGPCPEG QH VJG NWOKPQWU ƀQY
VJCPKPƀWQTGUEGPVQPGUYJKEJTGFWEGUVJGTGRNCEGOGPV
and maintenance costs.
In accordance with the main element which characterises
the mixture of gas and the pressure in the discharge tube,
the High Intensity Discharge (HID) lamps are distinguished
as follows:
1. High pressure mercury vapour lamps.
2. High pressure sodium vapour lamps.
3. Mercury vapour lamps with metal additives (commonly called metal halides).
4. Low pressure sodium vapour lamps.
~ Elevado rendimiento luminoso. Mayor cantidad de lúmenes por vatio de potencia consumida.
~ Proporcionan una fuente de luz compacta, que permite
WPDWGPEQPVTQNFGNCNW\EQPGNWUQFGUKUVGOCUTGƀGEtores adecuados.
`.CTICXKFC[OGLQTOCPVGPKOKGPVQFGNƀWLQNWOKPQUQSWG
GPNQUƀWQTGUEGPVGUNQSWGTGFWEGNQUEQUVQUFGTGRQUKción y mantenimiento.
De acuerdo con el elemento principal que caracteriza la
mezcla de gas y la presión en el tubo de descarga, las lámparas de Alta Intensidad de Descarga (HID) se distinguen
como sigue:
1. Lámparas de vapor de mercurio a alta presión.
2. Lámparas de vapor de sodio a alta presión.
3. Lámparas de vapor de mercurio con aditivos metálicos
(comúnmente llamadas de halogenuros metálicos).
4. Lámparas de vapor de sodio a baja presión.
These lamps, like all discharge lamps, present an impedance to the passing of the current which decreases as the
current increases, so they cannot be connected directly to
the power network without a device to control the intensity
which circulates through them. This device is what we normally call reactance or also ballast and carries out the following functions:
~ It limits and regulates the current of the lamp.
~ It supplies the suitable starting current during the arc stabilising phase.
~ In some cases, it provides the voltage required for the
lamp to light up.
Estas lámparas, como todas las de descarga, presentan
una impedancia al paso de la corriente que disminuye a medida que ésta aumenta, por lo que no pueden ser conectadas directamente a la red de alimentación sin un dispositivo
que controle la intensidad de corriente que circula por ellas.
Este dispositivo es lo que habitualmente llamamos reactancia o también balasto y realiza las siguientes funciones:
~ Limita y regula la corriente en la lámpara.
~ Suministra la corriente adecuada de arranque durante la
fase de estabilización del arco.
~ En algunos casos, suministra la tensión necesaria para
el encendido de la lámpara.
In addition, a good ballast must guarantee the following:
~ Good adjustment faced with supply voltage variations.
Además, una buena reactancia debe garantizar lo siguiente:
~ Buena regulación frente a las variaciones de la tensión
de alimentación.
~ Bajo calentamiento.
~ Funcionamiento sin ruido.
~ Limitación de componentes armónicos en las corrientes
de línea y de lámpara.
~ Pérdidas propias moderadas para lograr un buen rendimiento del conjunto.
~ Dimensiones apropiadas a las necesidades de los fabricantes de luminarias.
~ Garantizar al máximo la vida de la lámpara.
~ Low heating.
~ Noiseless operation.
~ Limitation of harmonic components in the line and lamp
currents.
`/QFGTCVGQYPNQUUGUVQCEJKGXGIQQFGHſEKGPE[
`&KOGPUKQPU YJKEJ CFCRV VQ VJG NKIJV ſVVKPI OCPWHCEVWTers’ needs.
~ Guarantee a long life of the lamp.
Each lamp has its own particular characteristics and thereHQTGPGGFUKVUURGEKſEDCNNCUV
For some of them, like the mercury vapour lamps, the netYQTMXQNVCIG
8KUUWHſEKGPVVQKIPKVGVJGNCOR(QT
others, high voltage must be available to achieve the ignition.
This high voltage can be supplied by the autotransformer
type ballast, as in the case of the low pressure sodium, or
by additional elements such as starters which provide simple
or multiple, high voltage pulses, required for the ionisation
of the gas and ignition of the lamp, which is the case of high
pressure sodium and metal halide lamps.
www.elt.es
Cada lámpara tiene unas características particulares y por
NQVCPVQPGEGUKVCWPCTGCEVCPEKCGURGEÈſEC
Para algunas de ellas, como las de vapor de mercurio, es
UWſEKGPVGEQPNCVGPUKÎPFGTGF
8RCTCGPEGPFGT
la lámpara. Para otras, es necesario disponer de alta tensión
para lograr el encendido. Esta alta tensión puede ser suministrada por la reactancia de tipo autotransformador, como
en el caso del sodio a baja presión, o por elementos adicionales como son los arrancadores, que proporcionan impulsos de alta tensión, simples o múltiples, necesarios para la
ionización del gas y arranque de la lámpara, cual es el caso
de las lámparas de sodio a alta presión y de los halogenuros
metálicos.
233
Dependiendo de la tensión de red disponible, su forma
constructiva y características de funcionamiento, los tipos
más utilizados son los siguientes:
Depending on the network voltage available, their shape
and operating characteristics, the most commonly used
types are the following:
~ Reactancias serie o simple impedancia.
~ Reactancias autotransformadoras.
~ Reactancias autorreguladoras.
~ Reactancias de doble nivel de potencia.
~ Series or simple impedance ballasts.
~ Autotransformer ballasts.
~ Self-regulating ballasts.
~ Bi-power system ballasts.
5KORNGKORGFCPEGDCNNCUVU
Reactancia de simple impedancia
6JKUKUWUGFYJGPVJGPGVYQTMXQNVCIGKUUWHſEKGPVVQGPsure the ignition and stable operation of the lamp. It is the
most simple, economical, smallest and with least losses, so
it is most commonly used system. It consists of an inductance connected in series to the lamp which limits and regulates the current.
5GWUCEWCPFQNCVGPUKÎPFGTGFGUUWſEKGPVGRCTCCTTCPcar y mantener estable el arco de la lámpara. Es la más
sencilla, económica, de menor tamaño y de pérdidas más
reducidas, por lo que es el sistema más usado. Consiste en
una inductancia en serie con la lámpara, que limita y regula
la corriente en la misma.
It must be taken into account that certain LP sodium and
metal halide lamps cannot operate with this type of ballast.
Debe tenerse en cuenta que determinadas lámparas de
sodio BP y halogenuros metálicos no pueden funcionar con
este tipo de reactancia.
The power adjustment faced with variations in the network
voltage is not very good, so a variation of 10% causes power
variations in lamps of 20 to 25%. Therefore, it must only be
WUGF KP EKTEWKVU YJGTG PGVYQTM XQNVCIG ƀWEVWCVKQPU FQ PQV
GZEGGFv
La regulación de potencia frente a las variaciones de la
tensión de la red no es muy buena, de tal forma que una
variación del 10% ocasiona variaciones de potencia en lámpara del 20 al 25%. Por ello, sólo debe utilizarse en circuitos
FQPFGNCUƀWEVWCEKQPGUFGVGPUKÎPFGTGFPQUWRGTGPGNv
5%.
R
L
REACTANCIA
EN SERIE
SERIES
BALLAST
~
C
N
#WVQVTCPUHQTOGTDCNNCUVU
Reactancias autotransformadoras
9JGP VJG PGVYQTM XQNVCIG KU PQV UWHſEKGPV VQ KIPKVG VJG
lamp, the use of autotransformer ballasts (magnetic leakage
autotransformer) is required. They operate by raising the
voltage to the exact value to start and maintain the arc of
the lamp.
%WCPFQ NC VGPUKÎP FG TGF GU KPUWſEKGPVG RCTC NQITCT GN
arranque de la lámpara, se hace necesario la utilización de
reactancias autotransformadoras (o autotransformador de
dispersión), las cuales elevan la tensión al valor preciso para
arrancar y mantener el arco en la lámpara.
This type of ballast, like the series ones, has low power
adjustment in lamp.
Este tipo de reactancia, al igual que las de serie, tienen
baja regulación de potencia en lámpara.
The correction of the power factor will always be in parallel
and we will have to use large capacity capacitors.
La corrección del factor de potencia será siempre en paralelo y habremos de utilizar para ello condensadores de gran
capacidad.
S
L
REACTANCIA
AUTOTRANSFORMADORA
~
AUTOTRANSFORMER
BALLAST
C
P
N
5GNHTGIWNCVKPIDCNNCUV
Reactancia autorreguladora
Its construction combines an autotransformer with a regulator circuit and a series capacitor. Its great advantage is the
good regulation of the power in the lamp faced with variations in the network voltage.
However, it is more bulky and has higher own losses than
a series ballast.
+VUGNGEVTKECNYKTKPIFKCITCOKUUJQYPKPVJGſIWTG
Su construcción combina un autotransformador con un
circuito regulador y un condensador en serie. Su gran ventaja es la buena regulación de la potencia en la lámpara frente
a las variaciones de la tensión de red.
Sin embargo, es más voluminosa y también tiene pérdidas
propias más altas que una reactancia de serie.
5WGUSWGOCGNÃEVTKEQGUGNFGNCſIWTC
C
S
L
REACTANCIA
AUTORREGULADORA
~
SELF- REGULATION
BALLLAST
P
N
234
www.elt.es
Tipos de reactancias ELT.
Aplicaciones de las mismas
6[RGUQH'.6DCNNCUVU
#RRNKECVKQPU
+PVGTKQTV[RG$CNNCUVUHQTDWKNVKPWUG
Tipo Interior-Reactancias a incorporar
Named with initials: VMI, VSI, VHI, VMMI and
85$+ 6Q DG KPUVCNNGF KP ſVVKPIU DQZGU ECDKPGVU
etc. That is, with an additional protection against
water, dust, humidity.
Never install in the foot of the lamp post, outdoors
or places where there is a lot of water condensation.
Denominadas con las siglas: VMI, VSI, VHI,
VMMI y VSBI. Para instalación en luminarias, cajas, armarios, etc. Es decir, con una protección adicional al agua, polvo, humedad.
No instalar nunca a pie de báculo, intemperie
o lugares donde haya fuertes condensaciones de
agua.
Encapsulated type
Tipo encapsulado
+FGPVKſGF YKVJ VJG KPKVKCNU 8/' 85' 8*' CPF
VSBE. These are ballasts with 6.6. polyamide proVGEVKQPECUKPIYKVJſDTGINCUUCPFRQN[WTGVJCPGTGUKP
encapsulation for greater protection against dust, humidity and rain.
+FGPVKſECFCU EQP NCU UKINCU 8/' 85' 8*' [
VSBE. Son reactancias con envolventes de proVGEEKÎP FG RQNKCOKFC EQP ſDTC FG XKFTKQ [ GPcapsuladas en resinas de poliuretano para mayor
protección contra polvo, humedad y lluvia.
Tipo Exterior -Alto Factor-Intemperie IP-54
'ZVGTKQT*KIJ(CEVQT1WVFQQTUV[RG+2
+FGPVKſGFYKVJVJGKPKVKCNU8/'#(85'#(8*'
AF and VSBE-AF. These are ballasts with protective
casing and polyurethane resin-encapsulation, with the
starter, capacitors for power factor correction and the
switching relay within the cases of level (2P). For outdoor use. The casings are made of 6.6 polyamide with
ITG[ſDTGINCUU+PDQVJV[RGUQHECUKPIVJG[JCXGCPGCUKN[TGmovable lower cover which enables the auxiliary components
to be changed or replaced. The outputs are with coloured
hoses indicating connection to line, lamp and control.
+FGPVKſECFCU EQP NCU UKINCU 8/'#( 85'#(
VHE-AF y VSBE-AF. Son reactancias con envolventes de protección y encapsuladas en resinas de
poliuretano, alojando en su interior el arrancador, los
condensadores para corrección del factor de potencia y el relé conmutador en los casos de doble nivel
de potencia (2P). Previstas para montaje a la intemperie.
.QUGPXQNXGPVGUUQPFGRQNKCOKFCEQPſDTCFGXKFTKQFG
color gris.Las salidas son con cables manguera de colores
indicativos del conexionado a línea, lámpara y mando.
Reactancias de Clase II
%NCUU++DCNNCUV
+FGPVKſGF YKVJ VJG KPKVKCNU 8/+ 85+ 8/' CPF
VSE---C2. These are ballasts with complete builtin equipment where all the parts are protected by
an insulating and long-lasting casing which presents possible contacts with active parts. Threepole connector for Line and lamp, also class II.
+FGPVKſECFCU EQP NCU UKINCU 8/+ 85+ 8/' [
VSE---C2. Son reactancias con equipo completo
incorporado en las que todas sus partes están
protegidas por una envolvente de poliamida 6.6
EQPſDTCFGXKFTKQFGEQNQTITKUCKUNCPVG[FWTCFGra, que evita posibles contactos con partes activas. Con conector tetrapolar para línea y lámpara
también de clase II.
ő$KRQYGTU[UVGOŒ
GPGTI[UCXKPIDCNNCUVU
Reactancias de ahorro de energía
“Doble nivel de potencia”
These are ballasts designed for facilities, normally public
lighting, where at certain time the lighting level can be reduced without noticeably reducing visibility, but with an important energy saving.
Its operation is based on ballasts which present an impedance to obtain the maximum level of the lamp and later
by means of a switching relay with line or timed control, it
connects an additional impedance which reduces the current
and the power in the lamp to a value of around 60% the rated
one, representing an approximate saving of 40% during the
whole time this operating system is maintained.
Further information can be found on the pages corresponding to this type of ballast.
Son reactancias destinadas a instalaciones, normalmente de alumbrado público, donde en horas determinadas se
puede reducir el nivel de iluminación sin una disminución
apreciable de la visibilidad, pero con un ahorro energético
importante.Su funcionamiento se basa en reactancias que
presentan una impedancia para obtener el nivel máximo de
la lámpara y posteriormente mediante un relé conmutador
con mando por línea o temporizado, conecta una impedancia adicional que disminuye la corriente y la potencia en la
lámpara a un valor de alrededor del 60% del nominal, suponiendo un ahorro aproximado del 40% durante todo el tiempo que se mantenga este régimen de funcionamiento.
Una información más amplia se encuentra en las páginas
correspondientes a este tipo de reactancias.
REACTANCIAS CON DOBLE NIVEL DE POTENCIA
BI - POWER SYSTEMS
MANDO
COMMAND WIRES
RELE
RELAY
T
R
R
L
L
C
C
A
N
A
N
CON LINEA DE MANDO
WITH COMMAND LINE SYSTEM
www.elt.es
RELE
CON CONMUTACIÓN TEMPORIZADA
WITH TIMER SIWTCHING SYSTEM
235
$KRQYGTU[UVGODCNNCUVU
HQTGPGTI[UCXKPI
Reactancias para ahorro de energía
doble nivel de potencia
As already known, these are ballasts designed for installations where, at certain hours of the day, the lighting level can
be reduced without considerably decreasing the visibility, but
with a considerable energy saving.
Como ya se conoce, son reactancias destinadas a instalaciones donde, a determinadas horas, se puede reducir el
nivel de iluminación sin una disminución importante de visibilidad, pero con un ahorro energético considerable.
As the reduction takes place at all the light points, there
are no longer any dark areas, which are dangerous for good
visibility, as occurs in installations where in order to save
energy, alternate points or even a whole line of lights are
switched off.
Como la reducción es en todos los puntos de luz, se eliminan las zonas oscuras, peligrosas por falta de visibilidad,
EQOQQEWTTGGPKPUVCNCEKQPGUFQPFGCſPFGCJQTTCTGPGTIÈC
se apagan puntos alternados o bien toda una línea de calzada.
Installation costs are avoided by not having double lines or
in quincunxes connections.
También se evitan los importantes costos de instalación al
no tener que tender dobles líneas o conexiones al tresbolillo.
Operation is based on the fact that they are ballasts which
initially give the maximum values to the lamp, obtaining the
OCZKOWO ƀQY HQTGUGGP CPF YJKEJ YG YKNN ECNN /#:+/7/
LEVEL or FIRST LEVEL.
Su funcionamiento se basa en que son reactancias que
inicialmente dan los valores máximos a la lámpara, obtePKÃPFQUGGNƀWLQO¶ZKOQRTGXKUVQGPNCOKUOC[SWGFGPQminaremos NIVEL MÁXIMO o PRIMER NIVEL.
At the time programmed on the device which activates the
control panel contactor of the installation, or on the timer of
each ballast, if these are the kind with “SM” control line; the
relay contactor of each ballast enables the terminal of the
winding to switch over to another of greater impedance, reFWEKPIVJGEWTTGPVKPVJGNCORVJGRQYGTCPFƀQYGOKVVGFD[
the lamp and, as a result, the power absorbed from the line.
Thus the REDUCED or SECOND LEVEL is obtained.
A la hora programada en el reloj temporizador que acciona el contactor del cuadro de control de la instalación o en
el temporizador de cada reactancia (si éstas son del tipo sin
línea de mando “SM”) el relé de cada reactancia permite
conmutar la borna de la bobina a otra de mayor impedancia,
TGFWEKGPFQNCEQTTKGPVGGPNCN¶ORCTCNCRQVGPEKC[GNƀWLQ
emitido por la misma y, como consecuencia, la potencia absorbida de la línea. Se obtiene así el NIVEL REDUCIDO o
SEGUNDO NIVEL.
Nivel máx.
Nominal power
Nivel reducido
Reduced power
Mando
Command wires
~
R
a
A
b
C1
Cco
The reduction of the lighting level according to the type
of lamp is considered optimum between 45 and 55% of that
obtained in the MAXIMUM LEVEL, which corresponds to
power percentages of between 58% and 63% of the power
absorbed from the network at that level; representing a saving of between 37 and 42% of the energy consumed during
the whole time we have the installation in these operating
conditions.
Parameters / Parámetros
El descenso del nivel de iluminación según el tipo de lámpara se considera óptimo entre el 45 y el 55% del obtenido
en el NIVEL MÁXIMO, lo que corresponde a porcentajes de
potencia entre el 58 y el 63% de la absorbida de red en dicho nivel, representando un ahorro entre el 37 y el 42% de
energía consumida durante todo el tiempo que tengamos la
instalación en estas condiciones de funcionamiento.
/CZKOWO.GXGNNivel Máximo
Reduced Level / Nivel Reducido
Power absorbed from network / Potencia absorbida de red
WT = 100%
58 ÷ 63% de WT
.CORƀQY(NWLQN¶ORCTC
Saving / Ahorro
ijL= 100%
42 ÷ 55% de ijL
42 ÷ 37% de WT
Greater power reductions are not advisable, as a lack of
stability can appear in the lamps.
Reducciones de potencia mayores no son aconsejables,
ya que puede aparecer falta de estabilidad en las lámparas.
Following to the recommendation of the lamp manufacturers, the ignition of the lamp is always done at maximum lighting level and during at least 5 minutes it is kept at maximum
level independently of the voltage in the command line.
Siguiendo la recomendación de los fabricantes de lámparas, el encendido siempre se realiza a nivel máximo y durante los 5 primeros minutos se mantiene a nivel máximo
independientemente de la tensión en el mando.
#FFKVKQPCNEQORGPUCVKQP
%#DCNNCUV
Compensación adicional. (Reactancia C.A.)
Additional Compensation (CA) is the name given to the
production of H.P. sodium ballasts, with double switched
contact relays, so that one of them, when the REDUCED
LEVEL enters, cuts off the capacity Cco of compensation
which is surplus respect to that which it had for the MAXIMUM LEVEL. Thus, during the operating hours at REDUCED
LEVEL, the compensation is adjusted to obtain cos ij = 0.90
vFWTKPIVJGYJQNGNKHGURCPQHVJGNCOR
Se le llama Compensación Adicional (C. A.) a la fabricación de las reactancias de sodio A.P. con relés de dobles
contactos conmutados, de forma que uno de ellos, al entrar
el NIVEL REDUCIDO, corta la capacidad Cco de compensación que le sobra respecto a la que tenía para el NIVEL
MÁXIMO. Así, durante las horas de funcionamiento en NIVEL REDUCIDO, la compensación está ajustada para obtener cos ij = 0,90 ± 0,05 en todo el tiempo de vida de la
lámpara.
236
www.elt.es
TABLE OF CAPACITIES FOR ADDITIONAL COMPENSATION
TABLA DE CAPACIDADES PARA COMPENSACIÓN ADICIONAL
%QORNGOGPVCT[QTCFFKVKQPCN
ECRCEKV[
Lamp power
/CZNGXGNECRCEKV[
4GFWEGFNGXGNECRCEKV[
Potencia lámpara
W
Capacidad nivel máx.
CT (μF)
Capacidad nivel reducido
C1 (μF)
Capacidad adicional o
complementaria
CCO (μF)
VSI 7/23-2P-CA
70
13
9
4
VSI 10/23-2P-CA
100
13
11
2
VSI 15/23-2P-CA
150
22
18
4
VSI 25/23-2P-CA
250
32
28
4
VSI 40/23-2P-CA
400
50
45
4
6[RGQHDCNNCUV
Tipo de reactancia
+FGPVKſECVKQPEQFGUHQTVJG'.6RTQFWEVU
%ÎFKIQUFGKFGPVKſECEKÎPFGNQURTQFWEVQU'.6
The ELT product types are comprised of a group of letters,
which identify the family they belong to, followed by digits
that indicate number of lamps, power and main voltages, and
ſPCNN[KPKVKCNUQTPWODGTUYJKEJGZRTGUUCP[URGEKCNRGEWliarity.
Los tipos de productos ELT se forman con un grupo de leVTCUSWGKFGPVKſECPNCHCOKNKCCNCSWGRGTVGPGEGPUGIWKFQFG
dígitos que indican número de lámparas, potencia y tensión
FGTGF[ſPCNOGPVGUKINCUQPÕOGTQUSWGFGENCTCPCNIWPC
particularidad especial.
Below are some essential types given as examples.
A continuación, como ejemplo, se explican algunos tipos
fundamentales.
PRODUCT IDENTIFICATION CODE: Ballast + Subset (RASE or RME)
CÓDIGO DE IDENTIFICACIÓN DE PRODUCTO: Reactancia + Conjunto relé (RASE o RME)
VMI 40/23 - 2P - RME - SM
VSI 40/23 - 2P - P - RASE - C A - SM
VSI: High pressure sodium vapour for built-in use
Vapor de sodio alta presión tipo interior
VMI: Mercury vapour for built in use
Vapor de mercurio tipo interior
Without control line (With timer)
Sin línea de mando (Temporizado)
“Open” contact relay (A) “closed” contact relay (C)
"Relé" contacto abierto (A) contacto cerrado (C)
Lamp power (7 = 70W, ...40 = 400W)
Potencia de lámpara (7 = 70W, ...40 = 400W)
With additional compensation (C)
Con compensación adicional (C)
Without additional compensation (..)
Sin compensación adicional (..)
Mains voltage (230V)
Tensión de red (230V)
By-power system
Doble nivel de potencia
RASE: Sodium ignitor pluggable relay
4GNÃCTTCPECFQTUQFKQGPEJWHCDNG
RME: Mercury pluggable relay
Relé mercurio enchufable
With thermal protection
Incorpora protección térmica
A#ő1RGPŒEQPVCEVCWZKNKCT[TGNC[
A%ő%NQUGFŒEQPVCEVCWZKNKCT[TGNC[
(_A) Contacto abierto /
(_C) Contacto cerrado
In a control gear with normally “closed” auxiliary contact
realy (C) without voltage accross the command wires, the
lamp works at maximum level.
En un equipo con relé de contacto cerrado (C) sin dar tensión a la línea de mando la lámpara funciona a plena potencia (nivel máximo).
In a control gear with normally “open” auxiliary contact relay (A) we should provide voltage to the command wires in
order to reach the lamp works at maximum level.
En un equipo con relé de contacto abierto (A) deberemos
dar tensión a la línea de mando para conseguir que la lámpara funcione a plena potencia (nivel máximo).
(We recommend the use of control gears with “closed”
auxiliary contact relay).
(Recomendamos utilizar preferentemente los equipos de
contacto cerrado).
L
C1
Red / Mains
N
220-240V
LAMP
C co
www.elt.es
237
Mando / Command
&KUVTKDWVKQPNKPGUKPKPUVCNNCVKQPU
YKVJD[RQYGTU[UVGO
Líneas de distribución en instalaciones de doble
nivel de potencia
To avoid possible operation anomalies of the level
switchover relays, as a result of a possible erroneous distribution and connection of the distribution and CONTROL
lines, these must be carried out as indicated in the following
diagrams:
Para evitar posibles anomalías de funcionamiento de los
relés de conmutación de nivel, como consecuencia de una
posible distribución y conexionado erróneos de las líneas de
distribución y de MANDO, es necesario realizar las mismas
según se indica en los esquemas siguientes:
DISTRIBUCIÓN A 3 FASES DE 230V SIN NEUTRO
3 PHASES AND NEUTRAL 230V DISTRIBUTION
Puntos de luz
Points of light
R
S 230V
T 230V
Puntos de luz
Points of light
DISTRIBUCIÓN A 3 FASES DE 400V Y NEUTRO
3 PHASES AND NEUTRAL 400V DISTRIBUTION
Puntos de luz
Points of light
N
R
S 400V
T 400V
N
6+/'&$+219'45;56'/DCNNCUVU
9KVJQWV%QOOCPFYKTGUō5/ō
Reactancias de DOBLE NIVEL DE POTENCIA
TEMPORIZADAS (Sin línea de Mando —SM—)
The essential characteristic of these ballasts consists in
that it is not necessary to install a command wires for the
centralised control of the level change, as they incorporate
a timed circuit per equipment which is responsible for the
change in level, once the pre-established time has elapsed
from the connection of the supply voltage.
La característica fundamental de estas reactancias consiste en que no es necesario instalar línea de mando para el
control centralizado del cambio de nivel, ya que incorporan
un circuito temporizado por equipo que se encarga de realizar el cambio de nivel, una vez transcurrido el tiempo predeterminado desde la conexión de la tensión de alimentación.
~ The rest of the physical and electric characteristics are
the same as the twin level ballasts with control line.
~ The timing leaves the factory pre-set at 4 1/2 hours. On
request they can be manufactured with other times.
~ El resto de características físicas y eléctricas son las
mismas de las reactancias de doble nivel con línea de
mando.
`.CVGORQTK\CEKÎPUCNGRTGſLCFCFGH¶DTKECCJQTCU
Bajo demanda se fabrican con otras temporizaciones.
L
N
238
www.elt.es
~ Switchover cycle.
0
~ Ciclo de conmutación.
41/2
The connection and disconnection are controlled by photocell or astronomic dial and the change in level is carried out
automatically by the equipment.
La conexión y desconexión la controla la fotocélula o reloj
astronómico y el cambio de nivel lo realiza el equipo automáticamente.
Thus the ignition of the lamp is always ensured at full power, as recommended by the lamp manufacturers.
De este modo se asegura siempre el encendido de la lámpara a plena potencia, tal y como lo recomiendan los fabricantes de lámparas.
Use
Utilización
These ballasts are designed to be used in installations carried out with single level equipment, where energy is to be
saved by replacing the existing equipment with twin power
level equipment, as the control wire does not exist or is too
costly to install.
Estas reactancias están previstas para ser utilizadas en
instalaciones realizadas con equipos de un solo nivel, en las
cuales se desea ahorrar energía sustituyendo los equipos
existentes por equipos de doble nivel de potencia, al no existir o ser muy costoso instalar el hilo de mando.
They can also be used in new installations where the control wire is not required.
También pueden utilizarse en nuevas instalaciones en las
cuales no se desea tender el hilo de mando.
$KRQYGTU[UVGOEQPVTQNIGCTUVKOGFYKVJ
CUVTQPQOKECNTGURQPUG
Reactancias de doble nivel de potencia
temporizadas con control astronómico
(Without command wires –SMI-)
(Sin línea de mando inteligente –SMI-)
The control gear incorporates a synchronized circuit behaving like an astronomical response commanded by a microprocessor. This micro automatically adjusts the switch
of the system to the reduced level according to calculated
OKFFNGQHVJGPKIJV6JWUQRVKOKUKPIKVUGPGTI[GHſEKGPE[HQT
any length of the night (e.g. summer-winter seasonal differences). The system avoids the need of a command line wire.
Además de no necesitar la instalación de una línea de
mando para el control centralizado del cambio de nivel, estos equipos incorporan un circuito sincronizado de respuesta
astronómica, mediante procesador, que ajusta automáticamente el paso a nivel reducido a la parte central de la noche,
QRVKOK\CPFQUWGſEKGPEKCRCTCEWCNSWKGTFWTCEKÎPFGNCPQche (diferencias estacionales, verano-invierno)
- Measures and memorizes the operational period of the
previous 4 nights in the case of the magnetic ballasts and
previous 3 days in the electronic ones.
- Mide diariamente la duración de la noche, memorizando
la media de los cuatro últimos días en el caso de reactancias electromagnéticas y de los tres últimos días en el de los
balatos electrónicos.
- With these data calculates the average “on” period.
- This average enable to make a forecast of the operative time of the following night and establish its medium time
point
- The reduced level is then activated two hours before this
RQKPVWPVKNſXGJQWTUCHVGTVJGRQKPV
- Other intervals could be programmed upon request
- In case of a switch-on <4h of the lighting installation (e.g.
day time maintenance) the microprocessor doesn’t take it in
account for calculations.
- The system protects the lamp against over voltage when
exceeding 260V (even if only for milliseconds). In this situation if it is working at full power, the system switches to its
reduced power level. When the mains supply drops below
250V it returns to the maximum power.
- With this system and timing, during the longest winter
nights, if the sun rises later than 5 hours after the average
mid point, the luminaire will come back up to the maximum
power and luminance. This situation will be kept until astronomic clock or photo cell switches off the mains feeding.
www.elt.es
- El aparato integra datos para lograr el centro del tiempo
de conexión del alumbrado.
- Lo va ajustando conforme varía el tiempo de encendido
del alumbrado.
- La programación estándar de entrada y salida de segundo nivel son de -2 horas y +5 horas respecto a ese punto
medio de funcionamiento del alumbrado.
- Bajo demanda se fabrican con otros intervalos para el
nivel reducido de potencia.
- Si hay un encendido de duración <4h. (por ejemplo labores de mantenimiento) el procesador no lo tiene en cuenta.
- El sistema protege la lámpara ante sobretensiones de
red por encima de los 260V, conmutando a nivel reducido
de potencia si ésta se genera cuando la lámpara funciona
a plena potencia y retornando al nivel inicial cuando baja
de 250V.
- Con este sistema y temporización, en noches largas de
invierno, cuando coincide el orto con las horas de inicio de
actividad el equipo retornará al nivel pleno de iluminación,
manteniéndose en éste hasta que el reloj astronómico o célula desconecte la alimentación.
239
SMI
ON
100% W lamp
0
OFF
3 latest nights´ average
Media de las últimas 3 noches
Switch-on
Conexión
de tensión
Power Lamp
W lámpara
SMI
( electrónica )
2h.
Full power
Plena potencia
60%
ON
Switch-off
Desconexión
de tensión
5h.
Power reduction
Potencia reducida
X/2 hours
X/2 horas
4 latest nights´ average
Switch-on
Power Lamp
100%
X hours
X horas
(electromagnética)
Time
Tiempo
2h.
100% W lamp
5h.
Full power
Plena potencia
60%
0
Power reduction
Potencia reducida
X/2 hours
OFF
Switch-off
100%
Time
X hours
- The mains switch-on and switch-off is controlled by the
photo-cell or astronomic clock and the control gear makes
the level change automatically.
- La conexión y desconexión la controla la fotocélula o
reloj astronómico y el cambio de nivel lo realiza el equipo
automáticamente.
- The lamp ignition is ensured to be made at full power according to lamp manufacturers’ recommendation.
- Se asegura siempre el encendido de la lámpara a plena potencia, tal y como lo recomiendan los fabricantes de
lámparas.
#RRNKECDKNKV[
Utilización:
As well as its predecessors these control gears are designed to be installed in installations equipped with standard
ballasts where we want to obtain easily energy savings. By
just replacing the existing ones with bi-power control gears,
where no command wire exists or to install one should be
very expensive.
Al igual que sus antecesoras SM, estas reactancias están
previstas para ser utilizadas en instalaciones realizadas con
equipos de un solo nivel en las que se desea ahorrar energía
sustituyendo los equipos existentes por equipos de doble nivel de potencia, al no existir o ser muy costoso instalar el
hilo de mando.
It is also applicable to new installations where no command line application is desired.
También pueden utilizarse en nuevas instalaciones en las
que no se desea tender el hilo de mando.
Responde in Madrid
Comportamiento en Madrid
SMI
18
20
22
24
2
4
6
8
10 h.
January
Enero
100%
W Lamp
70/60%
W Lamp
December
Diciembre
240
www.elt.es
$KRQYGTU[UVGOEQPVTQNIGCTUVKOGFYKVJ
CUVTQPQOKECNTGURQPUG
Reactancias de doble nivel de potencia
temporizadas con control astronómico
(Without command wire - SMI2)
(Sin línea de mando inteligente – SMI2)
SMI2 technology has the same features as the SMI with
the difference that the measurement time and the steps to
reduced levels are diverse .
El sistema SMI2 tiene las mismas características que el
SMI con la diferencia del tiempo de medición y de pasos a
niveles reducidos.
+PVJKUQEECUKQPVJGUVCPFCTFRTQITCOOKPIKPENWFGUCſTUV
step to a reduced level from 100 to 70 % (or 80%) and hour
NCVGT VQ QT NCVGT TGVWTPKPI VQ CPF ſPCNN[
100 %.
En esta ocasión la programación estándar contempla un
primer paso a nivel reducido de 100 a 70% (u 80%) y una
hora más tarde a 50% (o 60%) para posteriormente volver al
[ſPCNOGPVGGN
This technology has been applied to our electronic ballasts
for street lighting applications looking for the greatest energy
GHſEKGPE[
Esta tecnología se ha aplicado a nuestros balastos electrónicos para instalaciones de alumbrado público buscando
NCOC[QTGſEKGPEKCGPGTIÃVKEC
SMI2
( electrónica )
ON
2h.
Switch-on
Conexión
de tensión
Power Lamp
W l ámp ara
OFF
3 latest nights´ average
Media de las última s 3 noches
5h.
1h.
100% W lamp
Switch-off
Desconexión
de tensión
3h.
Full power
Plena potencia
70%
0
100%
70%
50%
X/2 hours
X/2 horas
X hours
X horas
Time
Tiempo
Response en Madrid
Comportamiento en Madrid
SMI 2
18
20
22
24
2
4
6
8
10 h.
January
Enero
100%
W Lamp
80/70%
W Lamp
60/50%
W Lamp
December
Diciembre
$CNNCUVUHQTFKUEJCTIGNCORU
Class II
Balastos para lámparas de descarga
Clase II
&GſPKVKQP
&GſPKEKÎP
Ballasts with complete integrated equipment: Ballast,
starter, p. f. corrector capacitor and connector for line and
lamp, class II.
Balastos con equipo completo integrado: Reactancia,
arrancador, condensador de corrección del f. de p. y conector para línea y lámpara, clase II.
www.elt.es
241
All the parts are protected with an insulating casing which
ensures the impossibility of contact with active parts or which
can become active due to a fault in the main insulation.
9JKEJ FGſPGU VJGO CU KPUWNCVKQP UCHGV[ CICKPUV GNGEVTKE
chokes class II.
They do not require earth connection.
Todas sus partes están protegidas con un envolvente aislante que asegura la imposibilidad de contacto con partes
activas o que puedan convertirse en activas por un fallo del
aislamiento principal.
.QSWGNCUFGſPGEQOQUGIWTKFCFFGCKUNCOKGPVQEQPVTC
choques eléctricos clase II.
No necesitan de conexión a tierra.
Uses
Usos
In installations where extreme safety is required against
electric chokes in order to guarantee the safety of the people, animals or goods. In short, class II installations.
En instalaciones donde se desee una seguridad extrema
contra choques eléctricos para garantizar la seguridad de
NCURGTUQPCUCPKOCNGUQDKGPGU'PFGſPKVKXCKPUVCNCEKQPGU
de clase II.
Also ideal for public lighting installations where due to
earth bypasses which exist in the equipment, the protection
differentials are activated frequently, cutting off the electricity, forcing the equipment (ballast, starter and capacitor) to
DG ſVVGF VQ KPUWNCVKPI RNCVGU VQ RTGXGPV EWTTGPVU NGCMKPI VQ
earth. Its total external insulating protection prevents these
currents without the need for additional insulating elements.
Igualmente idóneas para instalaciones de alumbrado
público donde, por derivaciones a tierra existentes en los
equipos, se activan con frecuencia los diferenciales de proVGEEKÎP EQTVCPFQ GN UGTXKEKQ GNÃEVTKEQ .Q SWG QDNKIC C ſLCT
los equipos (reactancia, arrancador y condensador) sobre
placas aislantes que evite las corrientes de fuga a tierra. Su
total protección aislante externa evita tales corrientes sin necesidad de elementos aislantes adicionales.
+PUVCNNCVKQP
(QTKPVGTKQTWUGTGSWGUVV[RGU85+%5#&QT#+
Instalación
Para uso interior solicitar los tipos VSI.../23-C2-AD o AI
They must be installed by securing them inside the light
ſVVKPIUQTJCPIKPIQPVJGKPUKFGQHVJGEQNWOPUD[CVNGCUV
two of their fastening holes.
5WKPUVCNCEKÎPFGDGUGTTGCNK\CFCſL¶PFQNQUGPGNKPVGTKQT
de luminarias o colgados en el interior de los báculos por al
OGPQUFQUFGUWUCIWLGTQUFGſLCEKÎP
(QTWUGQPVJGKPUKFGQHNKIJVſVVKPIUVJG[ECPDGUWRRNKGF
in “Compact assembly” format in type VSI.../23-CS-AI or in
“Interconnected sub-assembly” format types VSI.../23-C2S#+YJKEJECPDGſVVGFKPOQTGTGFWEGFURCEGUKHVJGEQORCEV
assembly does not allow this.
Para el uso en el interior de luminarias se pueden suministrar en formato “Conjunto compacto” en el tipo VSI.../23C2-AI o en el formato “Subconjuntos interconectados” tipos
85+%5#+SWGRGTOKVGPUGTſLCFQUGPGURCEKQUO¶U
reducidos si el conjunto compacto no lo permite.
They must not be installed outdoors as an independent
ballast, as they require additional protection against water.
No deben instalarse a la intemperie como reactancia independiente, pues requieren de una protección adicional
contra la caída de agua.
For their use, use ballasts type VSE.../23-C2-AI which,
made with the same insulating casing, have connection outlets with hoses and which installed in vertical position (wires
downwards), reach a protection degree of IP-54.
Para uso intemperie utilizar los balastos del tipo VSE.../23C2-AI que construidos con el mismo envolvente aislante, llevan salidas de conexión con cables manguera, y que instalados en posición vertical (cables hacia abajo) alcanzan un
grado de protección IP-54.
Foresee the capacity of the wire from the ballast to the
lamp to request them with dependent ignitor (AD) or independent ignitor (AI)
Prever la capacidad del cable desde el balasto a la lámpara para solicitarlas con arrancador dependiente (AD) o
arrancador independiente (AI).
/CKPUCPFNCOREQPPGEVKQP
(QTKPFQQTWUG
Conexión línea y lámpara
Para uso interior
The ballast has a protected class II connector which is
UGEWTGFVQVJGECUKPID[OGCPUQHCEQWRNKPIƀCPIGYJKEJ
prevents accidental disconnection.
El balasto lleva un conector protegido de clase II, que queda sujeto al envolvente mediante una uña de enganche que
impide una desconexión fortuita.
To disconnect, press the grooved button and pull the connector outwards.
Para desconectarlo, presionar el botón rayado y tirar del
conector hacia fuera.
The connection is made so that when withdrawing the setscrews from the cover, the “input” and “lamp” terminals apRGCTVQDGWUGFCEEQTFKPIVQſIWTG
La conexión se realiza de forma que al retirar los tornillos
FGſLCEKÎPFGNCVCRCEWDKGTVCCRCTGEGPNQUDQTPGUFGőNÈPGCŒ
[őNCORŒRCTCUGTWVKNK\CFQUUGIÕPſIWTC
Conectar el cable al contacto
central del portalámparas
Connecting cable to the central
contact of the lampholder
L
N
Línea
Mains
Lámp.
Lamp
242
www.elt.es
For outdoor use
Para uso exterior
$[OGCPUQHM8YKTGUKFGPVKſGFD[VJGKTRQUKVKQPQPG
for INPUT and another for LAMP.
/GFKCPVGECDNGUFGM8KFGPVKſECFQURQTUWRQUKEKQnamiento, uno para LÍNEA y otro para LÁMPARA.
Never work on the ballast unless the service voltage has
been withdrawn.
No operar nunca en el balasto sin retirar la tensión de servicio.
Conectar el cable al contacto
central del portalámparas
Connecting cable to the central
contact of the lampholder
Marrón
Brown
L
Azul
Blue
N
Linea
Line
Lampara
Lamp
Marrón
Brown
Azul
Blue
$CNNCUVUYKVJVJGTOCNRTQVGEVKQP
Reactancias con protección térmica
4GEVKH[KPIGHHGEV
'HGEVQTGEVKſECFQT
The rectifying effect is a phenomenon which can occur in
discharge lamps in a transitory way during ignition and permanently at the end of the lamp’s life.
At the end of the life of the lamps, due to aging in the cathodes and a loss of burner seal, a unidirectional current origiPCVGUKPVJGNCORRWNUGFCUUJQYPKPVJGHQNNQYKPIſIWTG
'NGHGEVQTGEVKſECFQTGUWPHGPÎOGPQSWGRWGFGPRTQFWEKT
las lámparas de descarga de forma transitoria en el encendiFQ[FGHQTOCRGTOCPGPVGCNſPCNFGUWXKFC
#NſPCNFGNCXKFCFGNCUN¶ORCTCUFGDKFQCNGPXGLGEKOKGPto de los electrodos y a la pérdida de estanqueidad del quemador, se origina una corriente de lámpara unidireccional
RWNUCFCVCN[EQOQUGOWGUVTCGPNCUKIWKGPVGſIWTC
lp: 7,9 A.
lrms = 5 A
0.750 A.
As it is a pulsing or unidirectional current, the impedance
found in the ballast is very low, causing the value of the current in the lamp to be much higher that the nominal of the
lamp.
Al tratarse de una corriente pulsante o unidireccional, la
impedancia que presenta la reactancia es muy baja, por lo
que el valor de la corriente es mucho mayor que el nominal
de la lámpara.
This situation causes dangerous heating in the ballasts
and independent ignitors, which can put the safety of the
equipment in danger.
Esta situación ocasiona peligrosos calentamientos en las
reactancias y en los arrancadores independientes, que pueden poner en peligro la seguridad del equipo.
To avoid this problem, the lamps must be replaced in accordance with the life expectancy indicated by the manufacturer and the equipment must have some type of protection
against these overload currents.
Para prevenir este problema, las lámparas deben ser reemplazadas según la expectativa de vida indicada por el fabricante y los equipos deben llevar alguna protección contra
estas sobrecargas.
The luminaire regulation EN 60598 demands thermal protection against this type of abnormal behaviour in the lamp.
La norma de luminarias EN 60598 exige que se disponga de una protección térmica frente a este comportamiento
anormal de la lámpara.
The protection can consist of an external thermal fuse or in
the case of use of ballasts with incorporated thermal protection; the equipment and lamp should be disconnected in the
face of this abnormality so protecting the whole circuit until
the lamp is replaced.
La protección puede consistir en un fusible térmico externo o en el uso de reactancias con protección térmica incorporada, que desconecten el equipo y la lámpara ante esta
anomalía, protegiendo todo el circuito hasta que la lámpara
sea repuesta.
www.elt.es
243
R
L
240V
230V
R L N
A
L
N
+IPKVQTUHQTFKUEJCTIGNCORU
Arrancadores para lámparas de descarga
Needs
Necesidad de los mismos
Mercury vapour lamps have electrodes which enable them
to ignite with low voltages, of around 200 V, so they do not
need any additional ignition device. However, metal halide
and high pressure sodium lamps require very high ignition
voltages which cannot be supplied by the ballast on its own.
Las lámparas de vapor de mercurio tienen electrodos que
le permiten el arranque con tensiones bajas, del orden de
los 200 V, por lo que no necesitan ningún dispositivo adicional para el arranque. Sin embargo, las de halogenuros
metálicos y las de sodio alta presión, necesitan tensiones
de encendido muy elevadas que no puede suministrarlas la
reactancia por sí sola.
Providing this ignition voltage is the mission of the ignitors,
which are also used to ignite some low pressure sodium vapour lamps.
El proporcionar esta tensión de encendido es la misión de
los arrancadores, que también se utilizan para el arranque
de algunas lámparas de vapor de sodio a baja presión.
1RGTCVKPIRTKPEKRNGU
Principios de funcionamiento
These are based on harnessing the energy stored in a capacitor which is discharged, by means of a suitable tripping
system, on the primary winding of the transformer. Due to
VJGUWFFGPXCTKCVKQPKPƀQYKPVJGEQTGCXQNVCIGRWNUGKPduced in the secondary winding appears for a short period
of time, with a very high peak value, which superimposed
on the network voltage, makes the arc on the inside of the
discharge tube jump.
Están basados en aprovechar la energía almacenada en
un condensador que se descarga, mediante un sistema de
disparo adecuado, sobre el bobinado primario de un transHQTOCFQT&GDKFQCNCDTWUECXCTKCEKÎPFGƀWLQGPGNPÕENGQ
del mismo, aparece un impulso de tensión inducido en el
secundario, de un valor de pico muy elevado y de corta duración que superpuesto a la tensión de red hace saltar el arco
en el interior del tubo de descarga.
According to its operating principle we can distinguish
three different types of ignitors:
~ Independent.
~ Pulse transformer.
~ Independent two-wire.
Según su principio de funcionamiento podemos distinguir
tres tipos diferentes de arrancadores:
~ Arrancador independiente.
~ Arrancador de transformador de impulsos.
~ Arrancador independiente de dos hilos.
#RCTV HTQO VJKU ENCUUKſECVKQP DCUGF QP KVU QRGTCVKQP VJG
ignitors can have a deactivation system on the inside which
cuts off the operation if the lamp does not ignite within a certain period of time, and which we call:
#FGO¶U FG GUVC ENCUKſECEKÎP RQT UW HQTOC FG HWPEKQPCmiento, los arrancadores pueden tener en su interior un
sistema de desactivación que corte su funcionamiento si la
lámpara no arranca en un plazo de tiempo, y que denominamos como:
~ Timed ignitors.
~ Arrancadores temporizados.
In the event of the lamp failing, this timing prevents the
ignitor from submitting the whole circuit to the effects of the
high voltage pulses for a long period of time.
Esta temporización evita que en caso de fallo de la lámpara, el arrancador someta a todo el circuito a los efectos
de los pulsos de alta tensión del arrancador durante largo
periodo de tiempo.
244
www.elt.es
+PFGRGPFGPVKIPKVQTQTUWRGTKORQUGFU[UVGO
5GTKGUKIPKVQT
Arrancador independiente o superposición de impulsos. (Arrancador serie)
6JKU YQTMU CU KPFKECVGF KP VJG FKCITCO QH ſIWTG %Cpacitor C is discharged by means of trip circuit D on the priOCT[NQQRUQHVTCPUHQTOGT6YJKEJCORNKſGUVJGRWNUGVQVJG
correct value. The voltage of the pulse depends exclusively
on the ignitor itself. It is compatible with any choke ballast
and this does not support the ignition pulses, whose value in
many cases is high.
(WPEKQPCUGIÕPGNGUSWGOCFGNCſIWTC'NEQPFGPUCdor C se descarga mediante el circuito de disparo D sobre
NCUGURKTCUFGRTKOCTKQFGNVTCPUHQTOCFQT6GNEWCNCORNKſEC
el impulso al valor adecuado. La tensión del impulso depende exclusivamente del propio arrancador. Es compatible con
cualquier reactancia de choque y ésta no soporta los impulsos de encendido, cuyo valor en muchos casos es elevado.
T
L
C D
Fig. 1
C
R
N
T : Transformador / Transformer
C : Condensador / Capacitor
R : Resistencia / Resistance
D : Circuito de disparo / Switch circuit
2WNUGVTCPUHQTOGTKIPKVQT
5GOKRCTCNNGNKIPKVQT
Arrancador de transformador de impulsos.
(Arrancador semiparalelo)
This uses the ballast to amplify the voltage pulses produced by the ignitor and operate according to the diagram of
ſIWTG%CRCEKVQT%KUFKUEJCTIGFD[OGCPUQHVJGVTKRRKPI
device D between points 2 and 3 of the ballast, which with
a suitable proportion of loops respect to the total of the coil,
CORNKſGUVJGRWNUGVQVJGTGSWKTGFXCNWG
7VKNK\C NC TGCEVCPEKC EQOQ CORNKſECFQT FG NQU KORWNUQU
de tensión producidos por el arrancador y funciona según
GN GUSWGOC FG NC ſIWTC 'N EQPFGPUCFQT % UG FGUECTIC
mediante el dispositivo de disparo D entre los puntos 2 y 3
de la reactancia, que con una adecuada proporción de esRKTCU TGURGEVQ CN VQVCN FG NC DQDKPC CORNKſEC GN KORWNUQ CN
valor necesario.
3
L
1
2
C
Fig. 2
D
C
N
Arrancador
Ignitor
R
C : Condensador / Capacitor
R : Resistencia / Resistance
D : Circuito de disparo / Switch circuit
The value of the pulses depends both on the ignitor itself
and on the ballast used and, therefore, a combination of both
is not always compatible. The ballast must have an intermediate connection and will be subject to the high peak voltages produced for the ignition.
El valor de los impulsos depende tanto del propio arrancador como de la reactancia utilizada y, por esto, no siempre
es compatible cualquier combinación de ambos. La reactancia debe llevar toma intermedia y estará sometida a las
elevadas tensiones de pico producidas para el encendido.
+PFGRGPFGPVVYQYKTGKIPKVQT
2CTCNNGNKIPKVQT
Arrancador independiente de dos hilos
(Arrancador paralelo)
6JKUYQTMUCEEQTFKPIVQVJGFKCITCOQHſIWTG6JGGPergy stored in capacitor C is returned to the lamp by the intervention of trip circuit D, in the precise instant when the
voltage passes through its maximum value, obtaining a
pulse with a peak value between 2 and 4 times that of the
instantaneous value of the network, reaching between 600
and 1.200 V, but lasting for longer and therefore with more
energy than those obtained with other ignitor systems.
(WPEKQPCUGIÕPGNGUSWGOCFGNCſIWTC.CGPGTIÈCCNmacenada en el condensador C es devuelta hacia la lámpara por la intervención del circuito de disparo D, en el preciso
instante en el que la tensión de aquélla pasa por su valor
máximo, obteniéndose un impulso de un valor de pico entre
2 y 4 veces el del instantáneo de la red, alcanzando entre
600 y 1.200 V, pero de mayor duración y, por lo tanto, de
más energía que los obtenidos con los otros sistemas de
arrancadores.
These are only used for some metal halide lamps and for
low pressure sodium ones of 35 W, which require relatively
low voltage pulses but with a certain width.
www.elt.es
Éstos son utilizados sólo para algunas lámparas de halogenuros metálicos y para las de sodio a baja presión de 35
W, que requieren impulsos de tensión relativamente bajos
pero de un ancho determinado.
245
L
R
Fig. 3
C
C
Arrancador
Ignitor
D
N
C : Condensador / Capacitor
R : Resistencia / Resistance
D : Circuito de disparo / Switch circuit
2GEWNKCTKVKGUQHVJGFKHHGTGPVV[RGUQHKIPKVQTU
Particularidades de los distintos tipos de arrancadores
Cada uno de los tres tipos de arrancador descritos tienen
características particulares, unas positivas y otras no, que
conviene conocer para poder seleccionar el más adecuado
en cada caso.
Each one of the three types of ignitors described, have
peculiar characteristics, some positive and others not, which
should be known in order to be able to select the most suitable one in each case.
+PFGRGPFGPVKIPKVQT
5WRGTKORQUGF5[UVGO
1.
It operates independently from the choke ballast installed as it does not need intermediate connection.
2.
It has the advantage that it does not submit the ballast
to high voltage pulses, so it does not require special
insulations.
3.
The lamp current runs through the ignitor so it must
be designed to support this, its use being limited to
those lamps whose current is equal or less than that
permitted by it.
As the lamp current runs through them, they present
own losses of a considerable value.
It must be placed near to the lamp to prevent the
pulse from weakening during the run between both.
However, the ballast can be at a distance from them.
They include the pulse transformer on the inside.
4.
5.
6.
Arrancador independiente. (Superposición de impulsos)
1. Su funcionamiento es independiente de la reactancia
de choque instalada, ya que no necesita toma intermedia.
2. Tiene la ventaja de que no somete a la reactancia a
los impulsos de alta tensión, por lo que ésta no necesita aislamientos especiales.
3. El arrancador está recorrido por la corriente de lámpara y ha de estar previsto para soportarla, quedando
limitada su utilización a las lámparas cuya corriente
sea igual o inferior a la permitida por aquél.
4. Al estar recorridos por la corriente de la lámpara, presentan pérdidas propias de un valor apreciable.
5. Debe colocarse próximo a la lámpara para evitar que
el impulso se debilite en el recorrido entre ambos. Sin
embargo, la reactancia puede estar alejada de ellos.
6. Son arrancadores que incorporan en su interior el
transformador de impulsos.
Arrancador de transformador de impulsos
Pulse transformer ignitor
1.
2.
3.
4.
+PFGRGPFGPVVYQYKTGKIPKVQT
1.
1.
It uses the ballast as a pulse transformer. This means
they can be used for any lamp power but the ballast
must have a loop ratio, between the intermediate and
ſPCNEQPPGEVKQPYJKEJKUUWKVCDNGHQTVJGKIPKVQTUQC
combination of both cannot be used.
It is economic, as it harnesses the ballast as a pulse
transformer.
The ballast must be made so that it can support the
high voltage pulses generated in the winding, bearing in mind that if the lamp does not come on due to
exhaustion or breakage, it must support them for long
periods of time, until the lamp is replaced.
The ballast and the ignitor must be together and both
as near as possible to the lamp. However, they admit
up to 10 m separation from the lamp and up to 20 m
with special wiring conditions.
2.
3.
4.
Utiliza la reactancia como transformador de impulsos. Esto permite utilizarlos para cualquier potencia
de lámpara, pero la reactancia ha de tener una reNCEKÎPFGGURKTCUGPVTGNCVQOCKPVGTOGFKC[NCſPCN
adecuada al arrancador, por lo que no sirve cualquier
combinación de ambos.
Es un arrancador económico, ya que utiliza la reactancia como transformador de impulsos.
La reactancia debe estar construida de modo que soporte los impulsos de alta tensión generados en su
bobinado, teniendo en cuenta que si la lámpara no
llega a encender por agotamiento o rotura, deberá
soportarlos durante períodos de tiempo prolongados,
hasta que se efectúe la reposición de la lámpara.
La reactancia y el arrancador han de estar juntos y ambos lo menos alejados posible de la lámpara. No obstante, admiten hasta 10 m. de separación de ésta y
hasta 20 m. con condiciones de cableado especiales.
Arrancador independiente de dos hilos
1.
They can only be used with certain metal halide and
low pressure sodium lamps which require pulses of
around 600 to 1.000 V peak voltage.
246
Son utilizables únicamente con determinadas lámparas de halogenuros metálicos y de sodio a baja presión que requieren impulsos del orden de 600 a 1.000
V de tensión de pico.
www.elt.es
1.
2.
1.
The pulse voltage, with a maximum value of 1,200 V,
means that in the event that the lamp does not ignite,
this does not represent a serious risk of perforation of
the insulations of the equipment.
They provide greater energy in the pulses and therefore the distance from the lamp at which they are
placed and the capacity of the wires affects them very
little.
2.
La tensión de impulso, de un valor máximo de 1.200
V., hace que en el caso de que la lámpara no llegue a
encender no suponga un riesgo grave de perforación
de los aislamientos del equipo.
Aportan mayor energía en los impulsos y por eso les
afecta muy poco la distancia de lámpara a la que se
coloquen ni la capacidad que presenten los cables.
&KIKVCNKIPKVQTYKVJVKOGT#85&2
2WNUG2CWUG6GEJPKSWG
Arrancador digital temporizado AVS 100-DP
(Técnica Pulso-Pausa)
This is a universal ignitor with timer which when combined
with ELT’s ballasts using the adequate socket and thanks to
the innovative “Pulse-Pause” technique, ensures the ignition
of High Pressure Sodium lamps from 50 to 1000W and of
Metal Halide lamps from 35 to 1800W.
Es un arrancador de tipo dependiente, temporizado y universal, que en combinación con las reactancias ELT con
toma adecuada, y gracias a la innovadora técnica “PulsoPausa”, asegura el encendido de las lámparas de Vapor de
Sodio Alta Presión de 50 a 1000W y Halogenuros Metálicos
de 35 a 1800W.
6GEJPQNQIKECNCFXCPVCIGU
CPFIGPGTCNEJCTCEVGTKUVKEU
Ventajas tecnológicas
y características generales
With the “pulse-pause” technique the high voltage impulse
time is reduced to a minimum and as a result the fatigue
in the electronic gear and the emission of interferences are
also reduced.
Con la técnica de “Pulso-Pausa” se reduce al mínimo el
tiempo de impulsos de alta tensión, con lo que se minimiza
la fatiga del equipo eléctrico y la emisión de interferencias.
The cycle lasts for aproximately 30 minutes, of which high
voltage impulses are only given for 2’ 15’’.
A microprocessor that switches-off the ignitor when detecting an exhausted or defective lamp is also incorpored.
The deactivated ignitor will automatically restart after the
restablishment of the voltage in the mains.
It allows for a high charge capacity, which allows the ignitor to be installed at greater distances from the lamp.
#FXCPVCIGUQXGTUWRGTKORQUGFV[RGKIPKVQTU
~ Smaller and lighter
~ Smaller own losses
~ Allows greater distances from the lamp
~ Less heating
~ Totally silent
~ Only one ignitor for the whole power range
#FXCPVCIGUQXGTRWNUGKIPKVQTU
~ More reliable in the ignition of metal halide lamps, which
allows them to be used with a wide range of High Pressure Sodium Vapour Lamps and Metal Halide Lamps.
El ciclo es de aproximadamente 30 minutos, de los cuales,
solo durante 2 minutos 15 segundos está dando impulsos de
alta tensión.
Además incorpora un microprocesador que desactiva el
arrancador cuando detecta una lámpara agotada o defectuosa.
El arrancador desactivado se rearma automáticamente
tras la reposición de la tensión de red.
Admite una capacidad de carga elevada, lo que permite
colocar el arrancador a mayor distancia de la lámpara.
Ventajas respecto a los arrancadores de tipo
independiente
~ Menor tamaño y peso
~ Menores pérdidas propias
~ Admite mayor distancia a la lámpara
~ Menor calentamiento
~ Totalmente silencioso
~ Un solo arrancador para toda la gama de potencias
Ventajas respecto a otros arrancadores de tipo
dependiente
`/¶UſCDKNKFCFGPGNGPEGPFKFQFGN¶ORCTCUFGJCNQIGnuros metálicos, lo que le permite ser utilizado para una
amplia gama de lámparas V.S.A.P. y Halogenuros Metálicos
~ Reduced the minimum time of high voltage impulses
avoiding fatigue in the gear.
~ Reduce al mínimo el tiempo de los impulsos de alta tensión evitando la fatiga del equipo.
1VJGTEJCTCEVGTKUVKEU
Otras características
~ Operates with ballasts with an adequate socket.
~ Avoids the classic switching on/off of burntout lamps so
saving energy.
~ When the starter is desactivated the lamps are kept
switched off making maintenance easier.
www.elt.es
~ Funciona con reactancia con toma adecuada.
~ Evita los clásicos encendidos y apagados de las lámparas agotadas, con el consiguiente ahorro de energía.
~ Al pasar el arrancador a situación de desactivado, mantiene la lámpara apagada y facilita la labor de mantenimiento.
247
Graph of the distribution of the Pulse-Pause
intervals in time
)T¶ſECFGFKUVTKDWEKÎPFGNQUKPVGTXCNQU
Pulso-Pausa en el tiempo
The dark area corresponds to the periods in which the
starter is giving impulses and the white area to the periods
in which it is not.
La zona sombreada corresponde a los periodos en los
que el arrancador está dando impulsos y las zonas en blanco a los que no da impulsos.
30’ OFF
Intervalos de tiempo
Intervals in time
(50Hz)
/CPWHCEVWTKPIUVCPFCTFU
Normas de fabricación
The standards applicable to the ignitors, and according to
which the ELT products are manufactured, are:
Las normas aplicables a los arrancadores y según las
cuales están fabricados los de ELT, son:
EN 61347-2-1
Devices for lamps-part 2-1: particular
requirements for starting devices (other
than glow starters).
EN 61347-2-1
EN 60927
Startings devices (other than glow starters). Performance requirements.
EN 60927
EN 60662
High pressure sodium vapour lamps.
EN 60662
EN 61167
Metal halide lamps.
EN 61167
RGEQOGPFCVKQPUHQTVJGWUGQHKIPKVQTU
Aparatos auxiliares para lámpara-parte
2-1: requisitos particulares para arrancadores (excepto arrancadores de destellos).
Aparatos arrancadores y cebadores (exEGRVQNQUFGGƀWXKQU2TGUETKREKQPGUFG
funcionamiento.
Lámparas de Vapor de Sodio a
alta presión.
Lámparas de halogenuros metálicos.
Recomendaciones para el uso de arrancadores
~ En primer lugar debemos elegir el arrancador adecuado
para las lámparas que deseamos instalar, de forma que
nos proporcione:
a) el voltaje de pico necesario,
b) número de impulsos exigidos para encender la lámpara
c) admita la capacidad de carga que suponen los cables
hasta la lámpara.
~ Debe cuidarse la ubicación de manera que haya siempre la mínima distancia desde el arrancador a la lámpara, para que la capacidad de los cables sea mínima y así
asegurar el encendido. Dicha capacidad depende de la
separación entre sí de los cables y de su longitud. Los
cables manguera, al tener los conductores muy próximos y trenzados, presentan capacidades altas (entre 70
[RHOOKGPVTCUSWGNQUECDNGUWPKſNCTGUEQPDWGP
aislamiento presentan capacidades mucho más bajas
(de 20 a 50 pf/m).
~ El conductor portador del impulso de la alta tensión, el
cual se indica en todos los arrancadores, debe de ser
de un aislamiento para tensión de servicio no menor de
1 kV (Tensión de prueba 3 KV). Y estar conectado al
contacto central del portalámparas para favorecer el encendido de la misma.
~ Respetar siempre la forma del conexionado que se indica en el esquema del arrancador.
~ Evitar que en el alojamiento del arrancador pueda haber
humedad, entrada de agua o condensaciones, ya que
ello puede provocar derivaciones entre terminales o a
tierra que nos anularían el impulso de alta tensión, no
produciéndose el encendido.
~ También hay que evitar una excesiva temperatura ambiente que pueda provocar un sobrecalentamiento en el
arrancador y ponga en peligro su duración.
~ Firstly we must choose the ignitor which adapts to the
lamps we wish to install, so that they provide us with:
a) The necessary peak voltage,
b) number of pulses required to ignite the lamp, and
c) admit the load capacity represented by the wires to
the lamp.
~ Care must be taken to locate them so that there is always a minimum distance from the ignitor to the lamp,
so that the wire capacity is minimum and thus ensure
the ignition. This capacity depends on the separation
between the wires and their length. Hoses, as the conductors are close together and braided, present high
capacities (between 70 and 150 pf/m) whilst one-wire
cables with good insulation present much lower capacities (from 20 to 50 pf/m).
~ The conductor bearing the high voltage pulse which is
indicated on all the ignitors, must have an insulation for
a service voltage of not less than 1 KV (Test voltage
3 KV). And be connected to the central contact of the
lamp-socket in order to favour the ignition.
~ Always respect the connection indicated on the ignitor
diagram.
~ Avoid humidity in the ignitor housing, as well as water
or condensation as this can cause bypasses between
terminals or to earth which would cancel the high voltage
pulse, not producing the ignition.
~ Excessive ambient temperatures must also be avoided
as these can cause overheating in the ignitor and can
endanger its duration.
248
www.elt.es
The temperature at the point indicated on its surface must
not exceed the value indicater for tc ... °C, when the lamp is
operating and thermally stabilised.
~ The ignitor produces voltages of up to 5 KV so special
care must be taken of the insulations of the cables which
UWRRQTVVJGOCPFPGXGTYQTMQPVJGNKIJVſVVKPIYKVJQWV
being sure that the supply voltage has been cut-off.
~ Keep the power factor correction capacitor connected in
order to avoid pulse losses towards the network.
.CVGORGTCVWTCGPGNRWPVQSWGUGKPFKECGPNCUWRGTſEKG
del arrancador, no debe sobrepasar el valor indicado para
tc ....°C, cuando la lámpara está funcionando y estabilizada
térmicamente.
~ El arrancador produce tensiones de hasta 5 KV; por ello
deben cuidarse especialmente los aislamientos de los
cables que los soportan y no trabajar nunca en la luminaria sin estar seguros de que la tensión de alimentación está cortada.
~ Tener conectado el condensador de corrección del factor de potencia para evitar pérdidas de impulso hacia
la red.
6[RKECNRCTCOGVGTUQHVJGKIPKVQTU
Parámetros característicos de los arrancadores
Below a description is given of the electric parameters of
the ignitors, whose values are given on the characteristics
sheets of each type.
5YKVEJQPXQNVCIGThis is the maximum line voltage at
which the ignitor must begin to give high voltage pulses.
A continuación se describen los parámetros eléctricos de
los arrancadores, cuyos valores se encuentran en las hojas
de características de cada tipo de arrancador.
5YKVEJQHHXQNVCIG Minimum line voltage at which the ignitor must stop producing pulses.
Tensión de desconexión: Tensión mínima de línea a la
cual el arrancador debe dejar de producir impulsos.
/CKPXQNVCIG Range of line voltages within which the ignitor can operate.
Tensión de vacío: Rango de tensiones de línea en la que
puede funcionar el arrancador.
2GCMXQNVCIGQHVJGRWNUGUThis is the maximum value
of the pulses generated by the ignitor. If this is lower than
that required for the ignition, the lamps cannot ignite. If it
is higher than the value permitted by the insulations of the
lamp-sockets and lamp sleeves, this can spoil them.
Tensión de pico de los impulsos: Es el valor máximo de
los impulsos generados por el arrancador. Si es más bajo
que el requerido para la ignición, las lámparas pueden no
encender. Si es más alto del valor permitido por los aislamientos de los portalámparas y casquillos de las lámparas,
puede estropearlos.
2WNUGYKFVJCVő:Œ-8 Width of the pulse measured at
ő:Œ -8 YJKEJ OWUV DG TGCEJGF VQ GPUWTG UWHſEKGPV GPGTI[
for the ignition.
Anchura del impulso a “X” KV: Anchura del impulso
medido a “X” KV, que debe ser alcanzado para asegurar la
UWſEKGPVGCRQTVCEKÎPFGGPGTIÈCRCTCGNGPEGPFKFQ
0WODGTQHRWNUGUNumber of pulses produced for each
period of the suply voltage.
Número de impulsos: Número de impulsos producidos
por cada periodo de la tensión de alimentación.
+ORWNUGRQUKVKQP Position in electric degrees where the
pulses of this voltage occur in each semi-period of the supply voltage.
Posición de fase: Posición en grados eléctricos donde se
producen los impulsos de esta tensión en cada semi-periodo
de la tensión de alimentación.
.QCF ECRCEKVCPEG Maximum load capacity admitted by
the ignitor for correct operation.
Capacidad de carga: La máxima capacidad de carga admitida por el arrancador para un correcto funcionamiento.
1YP NQUUGU The value of losses caused by the ignitor
when this is working with the maximum permissible current.
Pérdidas propias: El valor de pérdidas originadas por el
arrancador cuando está funcionando con la máxima corriente permitida.
0QTOCN JGCVKPI Maximum temperature increase in the
ignitor casing at the point indicated, over the ambient temperature where it is working, under normal conditions.
Calentamiento normal: Aumento máximo de temperatura en la envolvente del arrancador en el punto indicado,
sobre el ambiente en el que se halla funcionando, en condiciones normales.
6GORGTCVWTGCFOKVVGFKPVJGECUKPI
VE Maximum admissible temperature in the ignitor casing to guarantee the
life expectation foreseen.
Temperatura admitida en el envolvente (tc): Máxima
temperatura admisible en la envolvente
#ODKGPV VGORGTCVWTG QH WUG VC Range of ambient
temperatures (minimum-maximum) at which the ignitor can
operate in order to guarantee the life expectation foreseen.
Temperatura ambiente de utilización (ta): Rango de
temperaturas ambiente (mínima-máxima) a las que puede
funcionar el arrancador para garantizar la expectativa de
vida prevista.
6KOKPI Approximate time after which, if the lamp has not
ignited, the ignitor is deactivated until a new re-activation due
to cut-off and rest of the supply voltage.
Temporización: Tiempo aproximado tras el cual, si la
lámpara no ha encendido, el arrancador queda desactivado
hasta una nueva reactivación por corte y reposición de la
tensión de alimentación.
www.elt.es
Tensión de arranque: Es la máxima tensión de línea a
la que el arrancador debe comenzar a dar impulsos de alta
tensión.
249
+PUVCNNCVKQPTGEQOOGPFCVKQPU
Recomendaciones de instalación
6QQDVCKPCUCHGGHſEKGPVCPFNCUVKPIKPUVCNNCVKQPCUYGNN
as optimum operation and lifetime in the lamps with electromagnetic ballasts, the following recommendations should be
taken into consideration.
2CTCNQITCTWPCKPUVCNCEKÎPUGIWTCGſEC\[FWTCFGTCCUÈ
como el funcionamiento y vida óptimos de las lámparas con
reactancias electromagnéticas, se deben tener en cuenta
las siguientes recomendaciones.
C$CNNCUVCUUGODN[
a) Montaje de la reactancia
Assemble the ballasts as far away from each other and
from the lamps as possible to avoid excessive heating.
Montar las reactancias lo más separadas posible entre sí
y de las lámparas, para evitar excesivos calentamientos.
Ensure that the ballast is in contact with the surface of the
luminaire to achieve good heat transmission.
#UGIWTCTGNEQPVCEVQFGNCTGCEVCPEKCEQPNCUWRGTſEKGFG
la luminaria para conseguir una buena transmisión de calor.
(KZVJGDCNNCUVUVQVJGNWOKPCKTGWUKPICNNKVUſZKPIRQKPVUVQ
minimize the vibration generated by the dispersed magnetic
ſGNFCPFVQCXQKFPQKUG
(KLCTNCUTGCEVCPEKCUCNCNWOKPCTKCſTOGOGPVGWVKNK\CPFQ
todos sus puntos de anclaje para minimizar la vibración generada por el campo magnético disperso y evitar ruidos.
D9KTKPI
b) Cableado
Carry out the wiring according to the diagram marked by
the manufacturer on the ballast.
Realizar el cableado según al esquema eléctrico marcado
por el fabricante sobre la reactancia.
Respect the minimum wire section recommended by the
manufacturer.
Respetar la sección mínima de los cables recomendada
por el fabricante.
It is advisable to use a pitching tool in the case of using
OWNVKſNCTEQPFWEVQTU
'PGNECUQFGWVKNK\CTEQPFWEVQTGUOWNVKſNCTGUGUCEQPUGjable usar punterolas.
Respect the length of stripped cable, usually between 8
and 10mm.
Respetar la longitud de pelado de los cables, normalmente entre 8 y 10mm.
c) Input Voltage
c) Tensión de alimentación
The connection must always be carried out without voltage.
Se deben realizar siempre las conexiones en ausencia de
potencial.
Before switching on the installation, check that the input
voltage and frequency correspond to that marked on the ballast.
#PVGUFGNCRWGUVCGPOCTEJCFGNCKPUVCNCEKÎPXGTKſECT
que la tensión y frecuencia de alimentación corresponden
con lo marcado en la reactancia.
ELT’s ballasts can operate with the nominal indicated voltage with a tolerance of +/-10% during short periods of time
and permanently with a tolerance of +/-5%.
Las reactancias de ELT pueden funcionar con tensiones
de +/-10% de la nominal durante cortos espacios de tiempo,
y de forma permanente con tolerancias de +/-5%.
For larger deviations it is necessary to use adequate nominal voltage ballasts otherwise the life of the lamp could be
shortened.
Para desviaciones superiores de forma permanente, es
necesario utilizar reactancias de tensión adecuada, de lo
contrario se acortará la vida de la lámpara.
F'CTVJ9KTG
d) Conductor de tierra
For electrical security and to favour ignition, connect the
ballast and the metallic parts of the luminaire to the earth
wire.
Conectar la reactancia y las partes metálicas de la luminaria al conductor de tierra.
G%CRCEKVQTU
e) Condensadores
The power factor correction capacitor must be of the capacity and voltage recommended by the manufacturer of the
ballast.
El condensador de corrección del factor de potencia debe
ser de la capacidad y tensión recomendadas por el fabricante de la reactancia.
H+IPKVQTU
f) Arrancadores
It is necessary to know the requirements of the lamp that
is going to be used and the conditions of the installation to
correctly choose the ignitor, impulse, repetition, maximum
intensity, etc (see ignitor section)
Es necesario conocer los requisitos exigidos por la lámpara a utilizar y las condiciones de instalación, para una correcta elección del arrancador, impulso, repetitividad, intensidad
máxima, etc. (ver apartado de arrancadores).
g) Lamps
g) Lámparas
The electromagnetic ballasts have been designed to operate in certain lamps. The total compatibility between the
lamps and ballasts must be ensure. The operating position
recommended by the manufacturer must be respected.
Las reactancias electromagnéticas han sido diseñadas
para funcionar con unas lámparas determinadas. Se deberá
asegurar la completa compatibilidad entre las lámparas y las
reactancias. Respetar la posición de funcionamiento recomendada por el fabricante.
250
www.elt.es
The lamps must be replaced in accordance with the life
expectancy indicated by the manufacturer, to avoid problems in ignition and switch-offs, radio interferences, reducVKQP KP VJG NWOKPQWU ƀWZ CPF VJG TGEVKH[KPI GHHGEV V[RKECN KP
aging lamps. The use of ignitors with timers minimises these
problems.
Deben ser reemplazadas según la expectativa de vida
indicada por el fabricante, para evitar los problemas de encendidos y apagados, radiointerferencias, disminución de
ƀWLQ NWOKPQUQ [ GHGEVQ TGEVKſECFQT VÈRKEQU FG NCU N¶ORCTCU
envejecidas. El uso de arrancadores temporizados minimiza
estos problemas.
J1RGTCVKPICVOQURJGTG
h) Ambiente de funcionamiento
The temperature and humidity in the atmosphere in which
the electromagnetic ballast is installed is of vital importance
to its correct operation and total reliability.
La temperatura y la humedad ambiente en la que se encuentra colocada la reactancia electromagnética, es de vital
importancia para un funcionamiento óptimo y una plena gaTCPVÈCFGſCDKNKFCFFGNCOKUOC
The temperature in place where the ballast is located must
not exceed the temperature tw indicated in normal operating conditions and it must not exceed the temperature in the
winding. Continued operation at higher temperatures produces a progressive reduction in the life expectancy of the
ballast.
Se debe comprobar que la temperatura ambiente en el habitáculo de la reactancia no sea excesiva, no superando en
el bobinado, en condiciones normales de funcionamiento, la
temperatura tw indicada. Un funcionamiento continuado con
temperaturas superiores produce una reducción progresiva
de la esperanza de vida de la reactancia.
A correct degree of protection against humidity must be
ensured.
Se debe asegurar un grado de protección adecuado contra la humedad.
K6JGTOCN2TQVGEVKQP
i) Protección térmica
In accordance with regulation EN 60598-1 (Luminaires.
Part 1: General requirements and tests), excessive heating
must be avoided to prevent the possible appearance of the
rectifying effect at the end of the life of high pressure sodium
and metal halide lamps.
De acuerdo a la norma EN 60598-1 (Luminarias. Parte 1:
requisitos generales y ensayos), se deben prevenir los calentamientos excesivos ante la posible aparición del efecto
TGEVKſECFQTCNſPCNFGNCXKFCFGNCUN¶ORCTCUFGXCRQTFG
sodio alta presión y halogenuros metálicos.
ELT offers as an alternative ballasts with incorporated
thermal protection to avoid overheating.
ELT ofrece como alternativa reactancias que incorporan
protección térmica para evitar sobretemperaturas.
L/CKPVGPCPEG
j) Mantenimiento
All maintenance and replacement operations must be carTKGF QWV D[ SWCNKſGF RGTUQPPGN YJKNG VJG GSWKROGPV KU FKUconnected from the mains. All instructions given about the
product and current regulations must be strictly followed.
Todas las operaciones de mantenimiento y reposición de
componentes siempre deben ser realizadas por personal
EWCNKſECFQUKPVGPUKÎPFGTGFUKIWKGPFQTKIWTQUCOGPVGNCU
instrucciones dadas sobre el producto y la reglamentación
vigente.
M4GEQOOGPFCVKQPUHQTDKRQYGT
NGXGNKPUVCNNCVKQPU
k) Recomendaciones para instalaciones
doble nivel de potencia
~ Lamp manufacturers allow a 50% reduction in power, always when the ignition is carried out with nominal power.
~ In installations with high pressure sodium vapour lamps,
it is advisable to use equipment with the relay incorporated in it for additional compensation and to connect
two necessary capacitors.
~ It is not recommendable to use pivot reducers as the
reductions in mains voltage can cause the lamps to go
off at a reduced level.
~ Los fabricantes de las lámparas admiten una reducción
del 50% de la potencia siempre que se realice el encendido con potencia nominal.
~ En instalaciones con lámparas de vapor de sodio a alta
presión, es aconsejable utilizar equipos que incorporen
el relé para la compensación adicional y conectar los
dos condensadores necesarios.
~ No es recomendable el uso de reductores en cabeza ya
que las disminuciones de la tensión de red pueden ocasionar apagados de las lámparas en el nivel reducido.
If pivot reducers are used, the mains voltage must not be
less than 198V, to reduce the voltage exactly as the regulations indicate.
En caso de utilizar reductores en cabeza, la tensión de
red no debe ser inferior a 198V, para reducir la potencia tal y
como se indica en las normas.
/CPWHCEVWTKPIUVCPFCTFU
Normas de fabricación
ELT’s electromagnetic ballasts for high intensity discharge
lamps are manufactured in accordance with the following
standards:
Las normas según las cuales están fabricadas las reactancias electromagnéticas de ELT para lámparas de alta intensidad de descarga son:
EN 61347-1
EN 61347-2-9
www.elt.es
Auxiliary equipment for lamps, Part 1:
General and security requirements.
Auxiliary equipment for lamps, Parts 2-9:
Particular requirements for ballasts for
discharge lamps (EN 60922) (except
ƀWQTGUEGPVNCORU
EN 61347-1
EN 61347-2-9
251
Aparatos auxiliares para lámparas. Parte
1: requisitos generales y de seguridad.
Aparatos auxiliares para lámparas. Parte
2-9: requisitos particulares para reactancias para lámparas (EN 60922) de desECTIC
GZEGRVQN¶ORCTCUƀWQTGUEGPVGU
EN 60923
EN 60923
EN 60662
Ballasts for discharge lamps. Operating
requirements
Ballasts for high intensity discharge and
low pressure sodium lamps.
High pressure sodium vapour lamps
EN 60662
EN 61167
EN 60188
Metal halide lamps.
High pressure mercury vapour lamps.
EN 61167
EN 60188
EN 60192
Low pressure sodium vapour lamps.
EN 60192
EN 60598
EN 55015
Luminaires.
Limits and measuring methods of the
relative characteristics of radio electrical
disturbance of lighting and similar equipment.
EN 60598
EN 55015
EN 61000-3-2
Electromagnetic compatibility (EMC)
Part 3: Limits
Section 2: Limits for the harmonic current emissions (equipment with an input
current
equal to or less than 16A per
phase).
Equipment for general lighting use. Immunity requirements-EMC
EN 61000-3-2
ANSI C 82.4
EN 61547
ANSI C 82.4
EN 61547
Reactancias para lámparas de descarga.
Requisitos para el funcionamiento.
Reactancias para lámparas de alta intensidad de descarga y sodio a baja presión.
Lámparas de vapor de sodio a alta presión.
Lámparas de halogenuros metálicos.
Lámparas de vapor de mercurio a alta
presión.
Lámparas de vapor de sodio a baja presión.
Luminarias.
Límites y métodos de medida de las características relativas a la perturbación
radioeléctrica de los equipos de iluminación y similares.
Compatibilidad electromagnética (CEM).
Parte 3: Límites.
Sección 2: Límites para las emisiones de
corriente armónica (equipos con corriente de entrada menor o igual que 16 A por
fase).
Equipos para alumbrado de uso general.
Requisitos de inmunidad - CEM
6JGVGUVUVQGPUWTGVJGHWNſNOGPVQHVJGCRRNKECDNGTGIWNCtions for the emissions of radio-interference, harmonics and
immunity are carried out on the equipment made up of the
ballast, lamp, luminaire and wiring.
Los ensayos para el cumplimiento con las normativas
aplicables de emisión de radio-interferencias, armónicos e
inmunidad, deben ser realizados al conjunto formado por
reactancia, lámpara, luminaria y cableado.
ELT’s ignitors for high current discharge lamps are manufactured in accordance with the following regulations:
Las normas según las cuales están fabricados los arrancadores de ELT para lámparas de alta intensidad de descarga son:
Auxiliary equipment for lamps, Part 1:
General and security requirements.
Auxiliary equipment for lamps, Part 2-1
Particular requirements for ignitors ( exEGRVƀCUJKIPKVQTU
EN 61347-1
EN 60927
Starters and ignitors ( except emanation).
Particular requirements for operation.
EN 60927
EN 60662
High pressure sodium vapour lamps.
EN 60662
EN 61167
EN 55015
Metal halide lamps.
Limits and measuring methods of the
relative characteristics of radio electrical
disturbance of lighting and similar equipment.
Electromagnetic compatibility (EMC).
Part 3: Limits.
Section 2: Limits for the harmonic current
emissions (equipment with an input current equal to or less than 16A per phase).
EN 61167
EN 55015
Equipment for general lighting use. Immunity requirements-EMC.
EN 61547
EN 61347-1
EN 61347-2-1
(EN 60926)
EN 61000-3-2
EN 61547
EN 61347-2-1
(EN 60926)
EN 61000-3-2
6JGVGUVUVQGPUWTGVJGHWNſNOGPVQHVJGCRRNKECDNGTGIWNCtions for the emissions of radio-interference, harmonics and
immunity are carried out on the equipment made up of the
ballast, lamp, luminaire and wiring.
Aparatos auxiliares para lámparas. Parte
1: requisitos generales y de seguridad.
Aparatos auxiliares para lámparas.
Parte 2-1: requisitos particulares para
arrancadores (excepto arrancadores de
destellos).
Aparatos arrancadores y cebadores (exEGRVQNQUFGGƀWXKQU2TGUETKREKQPGUFG
funcionamiento.
Lámparas de vapor de sodio a alta presión.
Lámparas de halogenuros metálicos.
Límites y métodos de medida de las características relativas a la perturbación
radioeléctrica de los equipos de iluminación y similares.
Compatibilidad electromagnética (CEM).
Parte 3: Límites.
Sección 2: Límites para las emisiones de
corriente armónica (equipos con corriente de entrada menor o igual que 16A por
fase).
Equipos para alumbrado de uso general.
Requisitos de inmunidad-CEM.
Los ensayos para el cumplimiento con las normativas
aplicables de emisión de radio-interferencias, armónicos e
inmunidad, deben ser realizados al conjunto formado por el
equipo, lámpara, luminaria y cableado.
252
www.elt.es
'PGTI[GHſEKGPE[TGSWKTGOGPVUHQT*+&NCORDCNNCUVU
4GSWKUKVQUFGGſEKGPEKCGPGTIÃVKECFGNQU
Componentes para lámparas de Descarga
Commission Regulation of 18 March 2009 (EC) No.
245/2009 amended by the Commission Regulation of 21
April 2010 (EC) No. 347/2010 setting ecodesign requireOGPVU HQT ƀWQTGUEGPV NCORU YKVJQWV KPVGITCVGF DCNNCUV HQT
high intensity discharge lamps, and for ballasts and luminaires able to operate such lamps, and repealing Directive
2000/55/EC. These Regulations are both implementing the
Directive 2009/125/EC establishing a framework for the setting of ecodesign requirements for energy related products.
El Reglamento 245/2009 de 18 de marzo de 2009, corregido por el Reglamento 347/2010 de 21 abril 2010 es el que
implementa la Directiva 2005/32/CE del Consejo y del Parlamento Europeo, en relación a los requisitos de diseño ecológico para lámparas de alta intensidad de descarga, de balastos y de luminarias. Esta Directiva sustituye a la anterior
2000/55/CE. Dichos Reglamentos implementan la Directiva
2009/125/CE que instaura un marco para el establecimiento
de requisitos de diseño ecológico aplicables a los productos
relacionados con la energía.
6JGGHſEKGPE[KUFGſPGFCUVJGTCVKQDGVYGGPVJGRQYGTKP
the lamp divided by the total power consumption of the lampballast circuit. The method of measurement will be standardized by IEC 62442-2. This standard is currently under development and covers magnetic and electronic ballasts for High
Intensity Discharge lamps. The ballast is to be connected to
an equivalent circuit to establish the total power consumption. The value of the lamp power (measured or calculated)
is then divided by the total measurement in circuit to calculate the performance.
.CGſEKGPEKCXKGPGFGſPKFCRQTNCTGNCEKÎPGPVTGNCRQVGPEKC
en la lámpara dividida por la potencia total consumida por
el conjunto lámpara y balasto. El método de medición debe
realizarse según la norma IEC 62442-2; esta es una norma
que se encuentra en desarrollo e incluye a balastos electrónicos o magnéticos para lámparas de alta intensidad de descarga. El balasto se conecta a un circuito equivalente para
determinar la potencia total consumida. El valor de potencia
de la lámpara (medida o calculada) se divide entonces por
la potencia total de entrada del circuito de medición para
calcular el rendimiento.
The standard mains voltage in the EU is 230V. For that reason the measurements and calculations are made on the
basis of this mains voltage. 230V is being adopted as nominal voltage in an increasing number of countries all over the
world (e.g. Australia, India, etc.)
El voltaje estándar de suministro en toda la UE es de 230V,
por lo que las mediciones y cálculos se realizan sobre la
base de esta tensión de la línea. 230 V está siendo adoptada
como la tensión nominal en un número creciente de países
de todo el mundo (por ejemplo, Australia, India, etc...)
5VCIG
[GCTUCHVGTGPVT[KPVQHQTEG
HID ballasts must be labelled EEI=A3
Etapa 2 (13.04.2012) - tres años después de que el
Reglamento entró en vigor:
/KPKOWOGHſEKGPE[KPFGZFGſPGFCUFGſPGFKPVJGHQNNQYKPI
table.
0QOKPCNNCORYCVVCIG9
Potencia nominal de la lámpara (P)
/KPKOWODCNNCUVGHſEKGPE[
'ſEKGPEKCOÈPKOCFGNDCNCUVQ
DCNNCUV
P < 30
65
ŭ2ŭ
75
2ŭ
80
2ŭ
85
P > 405
90
5VCIG
Ō[GCTUCHVGTGPVT[KPVQHQTEG
Etapa 3 (13.04.2017) - ocho años después de que el
Reglamento entre en vigor:
HID ballasts must be labelled ''+#
/KPKOWOGHſEKGPE[KPFGZFGſPGFCUFGſPGFKPVJGHQNNQYKPI
table
0QOKPCNNCORYCVVCIG9
Potencia nominal de la lámpara (P)
Los balastos para descarga deben etiquetarse
como EEI = A2.
La eficiencia mínima queda definida en la tabla
/KPKOWODCNNCUVGHſEKGPE[
'ſEKGPEKCOÈPKOCFGNDCNCUVQ
DCNNCUV
P < 30
78
ŭ2ŭ
85
2ŭ
87
2ŭ
90
P > 405
92
The CE marking on the ballast states the conformity of the
ballasts to the requirements of the 245/2009 Regulation
'NOCTECFQ%'UQDTGDCNCUVQEQPUVKVW[GNCEQPſTOCEKÎP
por parte del fabricante de que el balasto se ajusta a los
requisitos del Reglamento 245/2009.
For more information:
http://celma.org/archives/temp/CElmA_EcoDesign_
(SM)258_CElmA_ELC_Tertiary_Lighting_Guide_2nd_
Edition_FINAL_December2010.pdf
www.elt.es
Los balastos para descarga deben etiquetarse como
''+#.CGſEKGPEKCOÈPKOCSWGFCFGſPKFCGPNCVCDNC
Para más información:
http://www.efilum.es/documentos/CElmA_guia_
aplicacion.pdf
253
SAFETY TRANSFORMEX INDEX
íNDICE TRANSFORMADORES DE SEGURIDAD
Dimmable electronic transformer for halogen lamps
DIGITALLY CONTROLED
Transformadores electrónicos regulables para lámparas
halógenas CONTROL DIGITAL .............................. 257
Safety transformers for halogen lamps. Class I
Transformadores de seguridad para lámparas
halógenas. Clase I ................................................... 258
Installation recommendations for transformers
Instrucciones para la instalación
de transformadores ................................................. 259
Halogen lamps. Generalities information
Lámparas Halógenas. Generalidades ..................... 261
Transformers for Halogen lamps.
Characteristics
Transformadores para lámparas halógenas.
Características......................................................... 262
Manufacturing standars
Normas de fabricación ............................................ 266
256
www.elt.es
Dimmable electronic transformer for halogen lamps
DIGITALLY CONTROLED
Transformadores electrónicos regulables para lámparas halógenas
CONTROL DIGITAL
29
38
3,6
122
131
Power
Model
Ref. No.
Modelo
Potencia
4CVGFCODKGPV
Temperature Tc
temperature
Input current
Corriente de
entrada
W
A
Output voltage
Tensión de salida
T. ambiente
máxima
Temperatura Tc
°C
°C
7PKVURGT
DQZ
Unidades
por caja
Approvals
Homologaciones
TCE 5/23-E
9810010
20... 50
0,23
12
50
70
25
01
TCE 6/23-E
9813030
20... 60
0,27
11,5
50
70
25
01
TCE 7/23-E
9813040
20... 70
0,31
11,5
50
75
25
01
TCE 10/23-E
9813050
20... 105
0,46
11,5
50
80
25
01
~ For LV Halogen lamps 12V.
~ Class II protection. Indoor use.
~ Small dimensions that allows installation inside:
40 x 30 mm. or ø50 mm.
~ Complete, with terminal cover and cable clamps.
~ Clamping screws on primary and secondary circuits for cables with
diameter: 3 mm. min. to 8 mm. max.
~ Max. section terminal area 2,5 mm2.
~ Suitable for installation on wooden surfaces.
~ Short circuit protection.
~ Overload protection.
~ Overhigh temperatures protection. (1)
(1)
Reset by switching the mains supply off and then on in models
type TCE 5, 6 and 7. In TCE 10 there is a power reduction.
~ Model TCE 5/23-E is suitable for 12Vac LED lamps MR16 type
5...25W.
~ No dimming with LED lamp.
~ Para lámparas halógenas de 12V.
~ Protección Clase II. Uso interior.
~ Dimensiones compactas, permite el montaje en espacios:
40 x 30 mm. o ø50 mm.
~ Equipados con cubre-clemas y prensa-cables
~ Cierra cables primario y secundario para conductores entre 3 y 8
mm. de diámetro.
~ Sección máxima en clemas del secundario: 2,5 mm2.
~ Aptos para el montaje sobre madera.
~ Protección contra cortocircuito.
~ Protección contra sobrecarga.
~ Protección contra sobretemperatura. (1)
(1)
En los modelos TCE 5,6 y 7 el transformador se rearma después
de desconectar y conectar la alimentación. El TCE 10 reduce
potencia.
~ El modelo TCE 5/23-E es válido para lámparas LED 5...25W 12Vac
tipo MR16.
~ Con lámpara LED no se puede regular.
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
Instructions manual on www.elt.es/productos/inst_manual.html
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
Manual de instrucciones en www.elt.es/productos/manual_instrucciones.html
ALLOWED DIMMERS / TIPO DE REGULADOR QUE ADMITE
Trailing-edge dimming (IGBT)
%QTVGCNſPCNFGHCUG
+)$6
C
with dimmer
con dimmer
230/240V
N
L
Dimmer
Minimum installation distance
Distancia mínima de instalación
Transformador Electrónico
Electronic Trafo
Lamp 12V
F
100
M
M
without dimmer
sin dimmer
12Vac LED lamp without dimmer
Lámpara LED 12Vac sin dimmer
230/240V
N
EN 61347-2-2 Safety / Seguridad
EN 61047 Performance / Funcionamiento
EN 61000-3-2 Harmonics / Armónicos
EN 55015 Interferences / Interferencias
EN 61547 EMC Immunity / Inmunidad CEM
www.elt.es
L
Transformador Electrónico
Electronic Trafo
Lamp 12V
257
TC-E
230-240V
50-60Hz
TR
230-11,5V
220-11,5V
50-60Hz
Safety transformers for halogen lamps. Class I
Transformadores de seguridad para lámparas halógenas. Clase I
TR-B
36
44
225
235
33,3
42,9
143
135
4
4
TR-SC
4,5
Model
Modelo
TR 5/23-01-SC
4,5
Power
Voltage AC
Current
Tensión
Intensidad
Ref. No. Potencia
2TKOCT[
Primario
Secondary
Secundario
2TKOCT[
Primario
Secondary
Secundario
VA
V
A
A
8224700
50
V
230
Rated voltage / Nominal: 12
Without charge / Vacío: 13,4
Incharge / Carga: 11,5
0,26
4,00
2TQVGEVKQP
CICKPUV
QXGTNQCFKPI
Protección
contra
sobrecargas
Fused protection
(To incorporated)
Fusible externo
(A incorporar)
Rated
CODKGPV
temp.
ţV
°K
Temp.
ambiente
máxima
Approvals
Homologaciones
°C
65
40
01
65
40
01
75
40
0,25A-TL (TR 5)
0,5A-TL (TR 105)
TR 5/22-01-SC
8224725
50
220
Rated voltage / Nominal: 12
Without charge / Vacío: 13,4
Incharge / Carga: 11,5
0,26
4,00
Fused protection
(To incorporated)
Fusible externo
(A incorporar)
0,25A-TL (TR 5)
0,5A-TL (TR 105)
TR 105/23-01-B
8224591
105
230
Rated voltage / Nominal: 12
Without charge / Vacío: 13,4
Incharge / Carga: 11,5
0,53
8,00
Fused protection
(To incorporated)
Fusible externo
(A incorporar)
-
0,25A-TL (TR 5)
0,5A-TL (TR 105)
~ Transformers for built-in use.Indoor use only.
~ Class I electrical protection.
~ Safety transformers with separated windings.
~ Class F (155 °C) insulation.
~ Windings class H (180 °C).
~ The transformer rated output shall be selected according to the
RQUUKDKNKV[QHCvXQNVCIGXCTKCVKQP
~ Under abnormal conditions the winding could reach up to
180 °C.
~ There are vacuum impregnated in polyester resin.
~ Earth connection to be employed only to supply earth continuity to
other devices.
~ It allows installation in dimensions up to
37 x 45 mm
and ø 55 mm.
2
~ Available with screw connection (2,5 mm ).
~ Further types on request.
~ Transformadores para incorporar. Uso exclusivo interior.
~ Protección eléctrica Clase I.
~ Transformadores de seguridad con devanados separados.
~ Aislamientos clase F (155 °C).
~ Devanados de clase térmica H (180 °C).
~ La potencia asignada del transformador se debe seleccionar
teniendo en cuenta que en la alimentación puede haber variaciones
del ±10%.
~ En condiciones anormales de funcionamiento el devanado podria
alcanzar hasta 180 °C.
~ Impregnadas al vacío en resina de poliéster.
~ Borne de tierra incorporado exclusivamente para dar continuidad de
tierra a otros equipos.
~ Permite el montaje en espacios
37 x 45 mm y ø 55 mm.
~ Disponibles con clema de conexión por tornillo (2,5 mm2).
~ Otros tipos bajo demanda.
Packaging and weight pag. 278 and www.elt.es/productos/packaging_ELT.pdf
Instructions manual on www.elt.es/productos/inst_manual.html
Embalaje y peso pág. 278 y www.elt.es/productos/embalaje_ELT.pdf
Manual de instrucciones en www.elt.es/productos/manual_instrucciones.html
Linea / Line
50/60 Hz
Primario
Primary
EN-61558-2-6
Secundario
Secondary
258
Fusible
protección
Protection
fuse
Carga / Load
www.elt.es
+PUVCNNCVKQPTGEQOGPFCVKQPU
for transformers
Instrucciones para la instalación de
transformadores
Safety
Seguridad
A low voltaje installation must be carried out whilst
taking the necessary precautions in order to respect the
safety principals in all the parts. The wires from the primary from the secondary not cross.
Una instalación de M.B.T. (muy baja tensión) debe
realizarse tomando las precauciones necesarias con
GNſPFGTGURGVCTNQURTKPEKRKQUFGUGIWTKFCFGPVQFCU
sus partes. Debe evitarse el contacto o cruce entre los
conductores de la red de alimentación y los de M.B.T.,
o bien asegurarse de que el aislamiento entre conducVQTGUUGC -8
Low voltage installations must be carried out taking
into account a number of safety principles. Mains and
LV leads must be kept separated otherwise it must be
assured that the isolation of the cables is higher than
4KV.
Las operaciones de mantenimiento y reposición deDGPUGTTGCNK\CFCURQTRGTUQPCNEWCNKſECFQUKPVGPUKÎP
de red siguiendo rigurosamente las instrucciones dadas
sobre el producto y la reglamentación vigente.
Maintenance operations must be performed by qualiſGFRGTUQPPGNYKVJPQOCKPUCRRNKGFCPFHQNNQYKPIVJG
entire given product instructions and the regulations currently in force.
/CKPURQYGT
Alimentación eléctrica
Mains voltage and mains frequency must be within
the normal range of operation.
La tensión y frecuencia de alimentación deben estar
dentro del rango normal de funcionamiento.
Make sure that the neutral is always connected in
3-phase supplies. In case of neutral interruption the input voltage of the single loads can be near to 400V that
results in high risk of failure.
Single-phase loads should be distributed evenly between the phases.
En instalaciones trifásicas a 400V., se debe asegurar que el neutro esté siempre conectado, si quedara
interrumpido, podrían llegar 400V a los equipos con el
consiguiente riesgo de avería. Al realizar la instalación,
se debe equilibrar al máximo el reparto de cargas entre
las fases.
Temperature
Temperatura
Transformers must be installed far enough from heat
sources to allow correct dissipation of its own heating.
Es necesario instalar los transformadores en lugares
alejados de fuentes de calor, favorecer una correcta
ventilación o refrigeración y asegurar un grado de protección adecuado contra la humedad.
Protection against humidity must be assured.
/CZKOWOCNNQYGFVGORGTCVWTG6EKUURGEKſGFQPVJG
transformer housing. Continuous operation of the transformer above Tc leads to a reduction of its lifetime accordingly.
En cualquier caso, no se debe superar la temperatura
tc marcada sobre la envolvente del transformador, ya
que, un funcionamiento continuado con temperaturas
superiores podría producir una reducción progresiva de
esperanza de vida.
Never keep the transformers covered by thermal insulation elements like stone wool blankets or others.
0QEWDTKTEQPOCPVCUFGſDTCFGXKFTKQWQVTQUCKUNCPVGU
térmicos.
9KTKPI
Cableados
Leads with suitable isolation, length, and cross-section
must be used.
Deben utilizarse cables con aislamientos, longitudes y
secciones adecuadas. Para una misma potencia, la intensidad que recorre un circuito, es 20 veces mayor a 12V que
a 230V.
Considering the same power, the current at 12V is 20
times higher than that at 230V.
Power
Potencia
www.elt.es
Secondary
12V lamp Current (A)
Secundario
Lámpara 12V Intensidad (A)
/CZKOWOCNNQYGFNGPIJV
O
Longitud máxima permitida (m)
1,5 mm2
2,5 mm2
50W
4.2
1,5
2,0
70W
5.8
1,5
2,0
100W
8.3
1,0
2,0
259
~ If two or more lamps are connected to the same transformer try to keep similar length of their wirings to avoid different light outputs due to voltage drop.
~ Take into account that leads installed near to the lamps
must support high temperatures.
`/CMGUWTGVJCVCP[EQPPGEVKQPKUſTON[FQPGVQOKPKOKUG
noticeable effects of contact resistance.
~ Si se instalan dos o más lámparas en un mismo transformador, los cables deben tener la misma longitud con el
ſPFGPQQDVGPGTFKHGTGPVGNWOKPQUKFCFGPECFCWPCRQTNCU
diferentes caídas de tensión en los cables.
~ Los cables situados en las proximidades de la lámpara
deben ser de materiales que puedan soportar altas temperaturas.
~ Asegurar la buena conexión del cableado para minimizar los notables efectos de la resistencia de contacto en las
conexiones.
+UQNCVKQPVGUV
Test de aislamiento
Si se realiza la prueba de aislamiento a la instalación, en
los circuitos que alimentan equipos electrónicos, el ensayo
se realizará aplicando la tensión de prueba entre las fases y
neutros todos unidos y el conductor de tierra. Nunca se aplicará tensión de prueba entre fases y neutro o entre fases.
Some precautions should always be followed, including:
The test voltage must be applied between earth connection and all the phases and the neutral that must be connected together.
The test voltage will never be applied between phases and
neutral or between phases.
'NGEVTQPKEVTCPUHQTOGTU
Transformadores electrónicos
Electronic transformers use very sensitive components.
This type of devices must be handle with care, as if you were
using any Hi-Fi system or DVD. Its installation must be carried out according to manufacturer recommendations in order to assure maximum lifespan and correct performance.
El transformador electrónico de control digital, utiliza componentes electrónicos sensibles. Debe ser tratado con cuidado, como si de un equipo de música, reproductor de DVD
o cualquier otro equipo electrónico. Su instalación requiere
seguir unas pautas acordes con las recomendaciones del
HCDTKECPVGEQPGNſPFGEQPUGIWKTWPCFWTCDKNKFCF[HWPEKQnamiento adecuado.
REACTION OF THE ELECTRONIC TRANSFORMER AND ITS PROTECTION SYSTEM
RESPUESTA DEL TRANSFORMADOR ELECTRÓNICO Y SISTEMA DE PROTECCIÓN
Type
Modelo
No lamp connected
1RGPEKTEWKV
Falta de lámpara.
Circuito abierto
TCE 5/23-E
TCE 6/23-E
TCE 7/23-E
Standby mode.
Ready to activate if
lampare replaced
Bloqueo:
En espera de reemplazo
de lámpara
Overload
Temperature > Tc
Sobre carga
6GORGTCVWTC 6E
After activation of the thermal protection
the lamps remain switched-off Lamps
can be re-ignited after a short cooling time
if a power off-on sequence is performed
The device switches-off
the secondary voltage.
Automatic restart
when the problem
is corrected
El equipo desconecta la
tensión en el secundario.
Rearma al ser solucionado
Bloqueo. Las lámparas permanecen
apagadas con el equipo sometido a
tensión hasta una nueva maniobra de
desconexión y conexión de la tensión
de alimentación tras un breve tiempo de
enfriamiento de equipo
Limited power output
TCE 10/23-E
5JQTVEKTEWKVGFUGEQPFCT[
XGT[NQYXQNVCIGUKFG
(12V)
Cortocircuito en la MBT
(12V)
Standby mode.
The device switches-off
the secondary voltage.
Automatic
restart when the problem
is corrected
Bloqueo.
El equipo desconecta
la tensión en el
secundario. Rearma
al ser solucionado
Input voltage
>250V
Tensión de
alimentación
8
Risk of failure
Riesgo de avería
Potencia de salida limitada
Bloqueo: Situación de "stand-by" o de reposo
260
www.elt.es
Halogen lamps
)GPGTCNKVKGU
Lámparas halógenas
Generalidades
A halogen lamp is a derivation of the incandescent lamp,
KPVJCVCUYGNNCUVJGICUYKVJYJKEJKVKUſNNGFCFGVGTOKPGF
SWCPVKV[QHEJGOKECNGNGOGPVUECNNGFJCNQIGPUUWEJCUƀWQrine, chlorine, bromine and iodine, are introduced.
Una lámpara halógena es una derivación de la lámpara
incandescente, en la que además del gas de llenado, se introduce una determinada cantidad de elementos químicos
FGPQOKPCFQUJCNÎIGPQUGPVTGNQUSWGFGUVCECPGNƀÕQTGN
cloro, el bromo y el yodo.
One of the biggest limitations of the conventional incandescent lamp is its short life, caused principally by use and
VJGITCFWCNGNKOKPCVKQPQHVJGOCVGTKCNYJKEJHQTOUVJGſNCment, material which falls off and becomes deposited in the
bulb of the lamp.
In halogen lamps, thanks to the fact that the halogen
and wolfram in a gaseous state can combine at temperatures over 250°C and separate when the temperature nears
u% C TGIGPGTCVKXG RTQEGUU KP VJG ſNCOGPV KU ECWUGF
which increases the average life. This process is known as
the halogen cycle.
Una de las grandes limitaciones de las lámparas incandescentes convencionales es su corta vida, motivada principalmente por el desgaste y eliminación paulatina del maVGTKCNSWGHQTOCGNſNCOGPVQGNEWCNUGXCFGURTGPFKGPFQ[
depositándose en la ampolla de la lámpara.
En las lámparas halógenas, gracias a que el halógeno y el
wolframio en estado gaseoso pueden combinarse a temperaturas superiores a 250°C y disociarse cuando se rebasan
NQU u% UG RTQFWEG WP RTQEGUQ TGIGPGTCVKXQ FGN ſNCmento que aumenta su vida media. Este proceso se conoce
como el ciclo del halógeno.
The halogen cycle
El ciclo del halógeno
The halogen cycle in the interior of a lamp occurs in the
following way:
El ciclo del halógeno en el interior de la lámpara se realiza
de la siguiente manera:
When the lamp is switched on, the halogen particles become gas and combine with the small quantity of wolfram
in the spiral which vaporizes at the high temperature which
makes it shine, before becoming deposited in the interior
wall of the bulb, turning it black.
Al encender la lámpara, las partículas del halógeno se gaUKſECP[UGEQODKPCPEQPNCRGSWGÌCECPVKFCFFGYQNHTCOKQ
de la espiral que se vaporiza por la alta temperatura a la
cual luce, antes de que se deposite en la pared interior de la
ampolla ennegreciéndola.
Due to the thermal convection currents inside the lamp,
this combination of gases is carried towards the spiral and
when nearing, the gases separate and the wolfram is deposKVGFQPVJGſNCOGPVYJKEJTGIGPGTCVGU6JGJCNQIGPKUHTGGF
to repeat the cycle.
Debido a las corrientes de convección térmica en el interior de la lámpara, esta combinación en forma de gas es
llevada hacia la espiral y al llegar a sus proximidades se
FKUQEKCFGRQUKV¶PFQUGGNYQNHTCOKQUQDTGGNſNCOGPVQCNSWG
regenera y quedando libre el halógeno para repetir el ciclo.
The regeneration of the spiral is not perfect, meaning that
the wolfram does not return to its original state or place and
although the cycle causes an improvement in the lamp’s life,
this improvement is not unlimited.
La regeneración de la espiral no se consigue de manera
perfecta, esto es, el wolframio no vuelve a su estado y lugar
original, por lo que aunque se consigue una mejora de la
vida de las lámparas, esta no es ilimitada.
%JCTCEVGTKUVKEU
of halogen lamps
Características
de las lámparas halógenas
These lamps have important advantages over incandescent lamps, among which the following must be highlighted:
~ Smaller dimensions in the lamp to achieve a minimum
temperature of 250°C, which also supposes the use of
glass with the highest resistance to temperature, almost
always quartz.
~ High luminous yield with longer duration, as well as higher luminance and colour temperatures.
`%QPUVCPVNWOKPQWUƀWZCPFEQNQWTVGORGTCVWTGVJTQWIJout the lamp’s whole life due to the the fact that the bulb
does not become blackened.
Estas lámparas poseen unas ventajas importantes sobre
las incandescentes, entre las que cabe destacar:
~ Menores dimensiones de la lámpara para conseguir la
temperatura mínima de 250°C, lo que supone también
el uso de vidrio más resistente a la temperatura, casi
siempre cuarzo.
~ Mayor rendimiento luminoso con más larga duración,
así como unas luminancias y temperaturas de color más
elevadas.
`%QPUVCPEKC FGN ƀWLQ NWOKPQUQ [ FG NC VGORGTCVWTC FG
color durante toda la vida de la lámpara al no ennegrecerse la ampolla.
Supply Voltage
Tensión de alimentación
The supply voltage is critical for the life length and lumiPQWUƀWZKPJCNQIGPNCORU
A nominal voltage ensures both parameters in a lamp,
a voltage lower than the nominal lengthens the life but deETGCUGU VJG NWOKPQWU ƀWZ CPF C JKIJGT XQNVCIG FGETGCUGU
the life but increases the luminosity.
La tensión de alimentación de las lámparas halógenas es
ETÈVKECGPNCXKFCFGÃUVCU[GPUWƀWLQNWOÈPKEQ
Una tensión nominal asegura ambos parámetros de la
lámpara, una tensión inferior a la nominal alarga la vida de
ÃUVC FKUOKPW[GPFQ UW ƀWLQ NWOÈPKEQ [ WPC VGPUKÎP UWRGTKQT
disminuye la vida de la lámpara aumentando su luminosidad
www.elt.es
261
It is preferable to supply halogen lamps with a voltage lower than the nominal, respecting permitted limits, to ensure
VJGNKHGNGPIVJCPFVQQDVCKPCUWHſEKGPVNWOKPQWUƀWZ
Es preferible alimentar a las lámparas halógenas con una
tensión inferior a la nominal, respetando los límites permitiFQURCTCCUGIWTCTNCXKFCFGÃUVCU[QDVGPGTWPƀWLQNWOKPQUQUWſEKGPVG
Very Low Safety Voltage (MBTS)
La muy baja tensión de seguridad (MBTS)
8GT[NQYUCHGV[XQNVCIGKUFGſPGFCUVJCVYJKEJFQGUPQV
exceed 50V of alternating current, or 120V of direct current
ſNVGTGFVJTQWIJEQPFWEVQTUQTVJTQWIJCP[EQPFWEVQTCPFVJG
earth, in a circuit whose insulation from the mains net is ensured by means such as a safety transformer.
&GſPKOQU/W[$CLC6GPUKÎPFG5GIWTKFCF
/$65CSWGlla que no excede de 50V en corriente alterna, o 120V en coTTKGPVGEQPVKPWCſNVTCFCGPVTGEQPFWEVQTGUQGPVTGEWCNSWKGT
conductor y tierra, en un circuito cuyo aislamiento de la red
de alimentación esté asegurado por medios tales como un
transformador de seguridad.
Lighting installations with Very Low Safety Voltage (MBTS)
ensure the safety of people against direct or accidental electrical discharges.
Las instalaciones de alumbrado de Muy Baja Tensión de
Seguridad (MBTS) aseguran la protección de las personas
contra las descargas eléctricas directas o accidentales.
Transformers
for halogen lamps
Transformadores
para lámparas halógenas
Very low voltage halogen lamps need devices which transform the mains voltage into the adequate voltage for their
operation. These devices are known as transformers.
Las lámparas halógenas de muy baja tensión necesitan
dispositivos que transformen la tensión de la red a la tensión
adecuada para su funcionamiento. Estos dispositivos se conocen como transformadores.
ELT offers both electromagnetic and electronic transformers, the latter are also known as converters.
ELT ofrece transformadores de seguridad tanto electromagnéticos como electrónicos, también llamados, éstos últimos, convertidores.
ELECTROMAGNETIC AND ELECTRONIC TRANSFORMERS. CHARACTERISTICS
TRANSFORMADORES ELECTROMAGNÉTICOS Y ELECTRÓNICOS. CARACTERÍSTICAS
%JCTCEVGTKUVKEU
'.6'NGEVTQOCIPGVKEVTCPUHQTOGT
'.6'NGEVTQPKEVTCPUHQTOGT
Características
Transformador electromagnético ELT
Transformador electrónico ELT
Security transformer
Transformador de seguridad
Output Voltage
Tensión de salida
Noiseless Operation
Funcionamiento sin ruido
Low Heating
Bajo calentamiento
This possesses a protective separation between the input and output
secondary coilings and is destined to supply very low voltage and safety circuits (MBTS) and very low protection voltage (MBTP).
Poseen una separación de protección entre los arrollamientos de
entrada y de salida y están destinados a alimentar circuitos de muy
baja tensión y seguridad (MBTS) y de muy baja tensión de protección
(MBTP).
This possesses a Very Low Safety Voltage in the secondary.
Poseen muy baja tensión de seguridad (MBTS) en el secundario.
This is designed with an output voltage which ensures the optimum life and luminous yield in halogen lamps.
Diseñados con una tensión de salida que asegura la vida óptima y el rendimiento lumínico de las lámparas halógenas.
Thanks to its design, low work induction, vacuum impregnation, and
low magnetic dispersion a noiseless operation is guaranteed.
Por su diseño, baja inducción de trabajo, impregnación al vacío y baja
dispersión magnética, se garantiza un funcionamiento sin ruido.
Its electronic design guarantees noiseless operation.
Su diseño electrónico garantiza un funcionamiento sin ruido.
Dimensions which guarantee an operation with low heating, which in turn achieves the transformer’s long life.
Dimensionados para garantizar un funcionamiento con reducidos calentamientos, que consiguen una larga vida del transformador.
Reliability
Manufactured with top quality materials which ensure great robustness
and reliability.
Manufactured with top quality components which ensure great
reliability.
Fiabilidad
Fabricados con materiales de primera calidad que aseguran gran
TQDWUVG\[ſCDKNKFCF
Fabricados con componentes de primeras calidades que aseguran
ITCPſCDKNKFCF
6TCPUHQTOGT%NCUUKſECVKQP
%NCUKſECEKÎPFGNQUVTCPUHQTOCFQTGU
C&GRGPFKPIQPVJGKTRTQVGEVKQPCICKPUVGNGEVTKE
UJQEMU
a) Según su protección contra los choques
eléctricos
Class I and Class II are manufactured.
Se fabrican en clase I y clase II.
Class I safety transformer
Transformador de seguridad de clase I
Is characterised by :
~ Windings separated and very low voltage (MBTS) windings.
~ Principal insulation in all conductive parts
~ Double insulation between primary and secondary
~ Terminal connection for conductor to earth incorporated
~ Needs protection and cut-off elements in the installation.
Se caracteriza por:
~ Devanados separados y a muy baja tensión (MBTS).
~ Aislamiento principal en todas sus partes conductoras.
~ Doble aislamiento entre primario y secundario.
~ Incorpora borne de conexión para conductor a tierra.
~ Necesita elementos de protección y corte en la instalación.
262
www.elt.es
Class II safety transformer
Transformador de seguridad de clase II
Is characterised by:
Se caracteriza por:
~ Windings separate and very low voltage (MBTS)
~ Double insulation which impedes contact with any metallic part susceptible to the mains power in the case of a
fault in the principal insulation.
~ Does not need differential protection and so does not
incorporate terminal connection to earth.
~ Devanados separados y a muy baja tensión (MBTS).
~ Doble aislamiento que impide el contacto con cualquier
parte metálica susceptible de estar a potencial de red en
caso de fallo del aislamiento principal.
~ No necesita protección diferencial, por lo que no incorpora borne para conexión a tierra.
D &GRGPFKPI QP VJGKT RTQVGEVKQP CICKPUV UJQTVEKTEWKVUQXGTNQCFKPICPFVGORGTCVWTG
b) Según su protección contra cortocircuito,
sobrecarga y temperatura
Depending on the protection the transformer has in the
face of abnormal operating conditions, the different types of
transformer can be recognised.
Dependiendo de la protección del transformador frente a
condiciones de funcionamiento anómalas, se pueden distinguir diferentes tipos de transformadores.
0QRTQVGEVKQPCICKPUVUJQTVEKTEWKVU
No protegido contra cortocircuitos
Transformers of this type do not incorporate devices
which protect against short-circuits, overloading and excessive temperature, and have to be externally assembled.
Los transformadores de este tipo, no incorporan dispositivos de protección contra cortocircuitos, sobrecarga
y sobre temperatura, teniéndose que colocar externamente.
ELT has safety transformers which are not resistant to
short-circuits, and in which the installation of a wire fuse
whose value and type are marked on the transformer is recommended.
ELT dispone de transformadores de seguridad no resistentes a cortocircuitos, en los que recomienda instalar en el
primario un fusible de hilo, cuyo valor y tipo se indica en el
marcaje del transformador.
2TQVGEVGFCICKPUVUJQTVEKTEWKVU
QXGTNQCFKPICPFVGORGTCVWTG
Protegido contra cortocircuitos, sobrecargas
y temperaturas
These transformers incorporate a protective device
which opens or reduces the circuit input current when
the transformer is overloaded or suffering from a shortcircuit. Once the overload has been eliminated, the
transformer will begin operating again in compliance with all
the regulation requirements.
Estos transformadores incorporan un dispositivo de
protección que abre o reduce la corriente del circuito
de entrada cuando el transformador está sobrecargado
o en cortocircuito. Una vez eliminada la sobrecarga, el
transformador vuelve a funcionar, cumpliendo todos los requisitos de la norma.
ELT’s transformers can the following protection devices
with the following characteristics available:
Los transformadores de ELT pueden disponer de los siguientes dispositivos de protección con las siguientes características:
2TQVGEVKXGFGXKEG
Fuse / Fusible
Thermostat / Termostato
PTC / PTC
Overload protection
Yes
Yes
Yes
Protege
Elemento protector
Contra sobrecargas
Protege
Protege
Short-circuiting protection
Yes
Yes
Yes
Contra cortocircuitos
Protege
Protege
Protege
Overheating protection
No protection
Yes
Yes
Contra calentamientos
No protege
Protege
Protege
Speed of reaction
Slow – Medium
Medium
Fast
Velocidad de respuesta
Lenta – Media
Media
Response of the protective
device to the anomaly
Respuesta a la anomalía
User action after anomaly
Actuación tras la anomalía
www.elt.es
Open circuit
(Unavailable reset operation)
Open circuit
(Resetting by cooling)
Circuito abierto
(no rearma)
Fuse replacement
(fuse rating higher than that
set by calculations does
not provide correct protection)
Reponer fusible
(si se coloca un fusible
de mayor calibre no protege)
Circuito abierto
(rearma por enfriamiento)
None
(Automatic resetting
after cooling of the device)
Innecesaria
(rearma automáticamente
al enfriarse la protección)
263
Rápida
Open circuit
(Resetting after mains off - on
operation and a short
cooling time of the device)
Circuito abierto
(rearma al cortar suministro
de tensión y un tiempo
de enfriamiento)
None (Automatic resetting
after mains interruption)
Innecesaria
(rearma automáticamente tras
el corte de suministro de tensión)
E&GRGPFKPIQPVJGYC[QHKPUVCNNCVKQP
6TCPUHQTOGTHQTŎDWKNVKPWUGŏ
c) Según su forma de instalación
Transformador “a incorporar”
Transformers designed to operate built into the box, casing or similar.
Transformadores diseñados para funcionar incorporados
en una caja, envolvente o similar.
Ŏ+PFGRGPFGPVŏVTCPUHQTOGT
Transformador “independiente”
Transformers which can be separately assembled on the
exterior of the luminaire and without additional casing.
Transformadores que pueden montarse separadamente
en el exterior de una luminaria y sin envolvente adicional.
All class II transformers manufactured by ELT are of an
independent type.
Todos los transformadores clase II fabricados por ELT son
de tipo independiente.
F&GRGPFKPIQPVJGUWTHCEGUQPYJKEJVJG[ECPDG
CUUGODNGF
F5GIÕPNCUUWRGTſEKGUGPNCUSWGUGRWGFCOQPVCT
Depending on the surfaces on which they can be assembled, they are marked with an indicative symbol for their use.
5GIÕP GP NCU UWRGTſEKGU GP NCU SWG UG RWGFCP OQPVCT
incorporan en el marcaje un símbolo indicativo de su uso:
~ Device which can be assembled incorporated in furniVWTGOCFGQHOCVGTKCNPQVEQPUKFGTGFVQJCXGQTFKHſEWNV
VQJCXGKPƀCOOCDNGEJCTCEVGTKUVKEU
~ Aparato que puede montarse incorporado en muebles
de materiales considerados con características difícilOGPVGQPQKPƀCOCDNGU
~ Device which can be assembled incorporated in furniVWTGOCFGQHOCVGTKCNYJQUGƀCOOCDKNKV[KUPQVMPQYP
~ Aparato que puede montarse incorporado en muebles,
FQPFGPQUGEQPQEGPNCUECTCEVGTÈUVKECUKPƀCOCDKNKFCF
de sus materiales.
~ Normal operation <95°C
~ Funcionamiento normal <95°C
~Abnormal operation <115°C
~ Funcionamiento anormal <115°C
M
M
M
M
(Temperature requirements in accordance with regulation
VDE 0710 part 14).
(Requisitos de temperatura según norma VDE 0710 parte
14)
~ Device which can be assembled on surfaces which are
PQTOCNN[KPƀCOOCDNG
`#RCTCVQSWGRWGFGOQPVCTUGUQDTGUWRGTſEKGUPQTOCNOGPVGKPƀCOCDNGU
(NWZTGIWNCVKQP
4GIWNCEKÎPFGƀWLQ
Regulators or dimmers can be used to make possible the
TGFWEVKQPQHVJGNWOKPQWUƀWZHTQOVJGJCNQIGPNCORUVQQDtain different levels of illumination.
Se pueden utilizar reguladores o dimmers que posibilitan
NC TGFWEEKÎP FGN ƀWLQ NWOKPQUQ FG NCU N¶ORCTCU JCNÎIGPCU
para obtener distintos niveles de iluminación.
The regulators or dimmers are connected in the primary, in
series with the phase.
Los reguladores o dimmers se colocan en el primario, en
serie con la fase.
L
N
264
www.elt.es
Different types of dimmers exist in function with the way
VJGXQNVCIGKUEWVVQECTT[QWVVJGƀWZTGIWNCVKQP
Existen distintos tipos de dimmers en función de la forma
FGTGEQTVGFGNCVGPUKÎPRCTCTGCNK\CTNCTGIWNCEKÎPFGNƀWLQ
.GCFKPIGFIGFKOOKPIRegulation by means of cut-off
in the wave on its rising side, from the beginning (phase cutoff at ignition). This is habitually used in halogen lamps supplied through electromagnetic transformers.
Leading-edge dimming: Regulación mediante recorte de
NCQPFCFGTGFGPUWƀCPEQFGUWDKFCFGUFGGNKPKEKQ
EQTVG
de fase en el encendido). Es el empleado habitualmente en
lámparas halógenas alimentadas a través de transformadores electromagnéticos.
6TCKNKPIGFIGFKOOKPIRegulation by means of cut-off in
the wave on its descending side, from the end cutting backwards (phase cut-off at switch off). This is the most suitable
for halogen lamps supplied through electronic transformers.
Trailing-edge dimming: Regulación mediante recorte de
NCQPFCFGTGFGPUWƀCPEQFGDCLCFCFGUFGGNſPCNTGEQTtando hacia atrás (corte de fase en el apagado). Es más
adecuado para lámparas halógenas alimentadas a través de
transformadores electrónicos.
TheNGCFKPIGFIG method of regulation is the least suitable for electronic transformers, due to the fact that the regulators that exist on the market, based on this principal, have
a circuit for eliminating the interferences generated by these
cuts in the wave, affecting said circuit at the ignition of the
electronic transformers, producing undesirable oscillations.
El método de regulación Leading-edge es menos adecuado para los transformadores electrónicos, debido a que
los reguladores que existen en el mercado, basados en este
principio, poseen un circuito para la supresión de las propias interferencias que generan estos recortes de la onda,
afectando dicho circuito al arranque de los transformadores
electrónicos, produciendo oscilaciones indeseadas.
Electronic transformers which allow both ways of regulation, and even offer regulation by means of an external potentiometer connected to two suitable terminals are already
available on the market.
Ya existen en el mercado transformadores electrónicos
que admiten ambas formas de regulación, e incluso ofrecen
regulación mediante un potenciómetro externo conectado a
sus dos terminales apropiados.
With electromagnetic transformers, if the regulation is to
be controlled individually, potentiometers for use in inductive
circuits are usually used, inserted in the primary supply line.
The life of halogen lamps is reduced when they operate
with dimmers due to the fact that, as they operate below their
nominal characteristics, they do not achieve suitable condiVKQPUHQTVJGJCNQIGPE[ENGVQVCMGRNCEGUQVJGſNCOGPVKP
the lamp does not regenerate.
www.elt.es
Con transformadores electromagnéticos, si la regulación
se quiere controlar de forma individual, se suelen utilizar potenciómetros de uso con circuitos inductivos, intercalados en
la línea de alimentación del primario.
La vida de las lámparas halógenas se reduce cuando funciona con dimmers debido a que, al trabajar por debajo de
sus características nominales, no se consiguen las condiciones adecuadas para que tenga lugar el ciclo del halógeno
SWGTGIGPGTCGNſNCOGPVQFGNCN¶ORCTC
265
/CPWHCEVWTKPIUVCPFCTU
Normas de fabricación
ELT’s transformers for incandescent lamps are manufactured in compliance with the following regulations:
Los transformadores para lámparas incandescentes de
ELT están fabricados conformes a las siguientes normas:
EN 61558-1
Transformer, supply unit and analogue
unit safety.
Part 1: General requirements.
Transformer, supply unit and analogue
unit safety.
Parts 2-6: Particular requirements for
safety transformers for general use.
EN 61558-1
EN 61347-1
Auxiliary equipment for lamps.
Part 1: General and safety requirements.
EN 61347-1
EN 61347-2-2
(EN 61046)
Particular requirements for electronic
converters supplied by direct or alternating current for incandescent lamps.
EN 61347-2-2
(EN 61046)
EN 61047
Electronic reduction converters supplied
by direct or alternating current for incandescent lamps. Operating requirements.
EN 61047
EN 55015
Limits and measuring methods of the
relative characteristics of radio electrical
disturbance of lighting and similar equipment
Electromagnetic compatibility (EMC)
Part 3: Limits
Section 2: Limits for the harmonic current
emissions (equipment with an input current equal to or less than 16A per phase).
EN 55015
Equipment for general lighting use. Immunity requirements-EMC.
EN 61547
EN 61558-2-6
EN 61000-3-2
EN 61547
EN 61558-2-6
EN 61000-3-2
6JGVGUVUVQGPUWTGVJGHWNſNOGPVQHVJGCRRNKECDNGTGIWNCtions for the emissions of radio-interference, harmonics and
immunity are carried out on the equipment made up of the
ballast, lamp, luminaire and wiring.
Seguridad de los transformadores, unidades de alimentación y análogos. Parte
1: requisitos generales y ensayos.
Seguridad de los transformadores, unidades de alimentación y análogos.
Parte 2-6: requisitos particulares para los
transformadores de seguridad para uso
general.
Aparatos auxiliares para lámparas.
Parte 1: requisitos generales y de seguridad.
Requisitos particulares para convertidores
electrónicos alimentados por corriente
continua o alterna para lámparas incandescentes.
Convertidores reductores electrónicos
alimentados por corriente continua o alterna para lámparas de incandescencia.
Prescripciones de funcionamiento.
Límites y métodos de medida de las características relativas a la perturbación
radioeléctrica de los equipos de iluminación y similares.
Compatibilidad electromagnética (CEM).
Parte 3: Límites.
Sección 2: Límites para las emisiones de
corriente armónica (equipos con corriente de entrada menor o igual que 16 A por
fase).
Equipos para alumbrado de uso general.
Requisitos de inmunidad-CEM.
Los ensayos para el cumplimiento con las normativas
aplicables de emisión de radio-interferencias, armónicos e
inmunidad, deben ser realizados al conjunto formado por
equipo, lámpara, luminaria y cableado.
266
www.elt.es
GENERAL INFORMATION INDEX
íNDICE INFORMACIÓN GENERAL
Approvals for ELT ballasts
Homologaciones de las reactancias ....................... 269
The Marking
El Marcado ............................................................. 274
Marks and indications
Marcas e indicaciones ............................................ 269
ELT product warranty
Garantia para productos ELT ................................. 275
Quality Management
Gestión de calidad .................................................. 272
268
www.elt.es
#RRTQXCNUHQT'.6DCNNCUVU
Homologaciones de las reactancias
All the ELT ballasts are manufactured according to the
national and international standards corresponding to each
product. As a result, many of them have been tested and
SWCNKſGFD[5RCPKUJ'WTQRGCPCPFGXGP#OGTKECPEGTVKſECtion organisations, such as the following:
Todas los productos ELT son fabricados según las normas nacionales e internacionales correspondientes. Como
consecuencia, muchos de ellos han sido ensayados y hoOQNQICFQURQTQTICPKUOQUFGEGTVKſECEKÎPGURCÌQNGUGWTQpeos e incluso americanos, como los siguientes:
ELT has obtained the EN-EC mark for its products, too,
which is granted by AENOR. This mark was established by
the CENELEC and recognised by the 18 European countries
which signed the LUM-AGREEMENT and which includes all
the marks of the respective countries, permitting the free circulation of the products bearing this mark in all the countries.
ELT ha obtenido para sus productos también la marca ENEC, concedida por AENOR. Marca que fue establecida por
GN%'0'.'%[TGEQPQEKFCRQTNQURCÈUGUGWTQRGQUſTOCPtes del acuerdo LUM-AGREEMENT, y que engloba todas las
marcas de los países respectivos, permitiendo en todos ellos
la libre circulación de los productos portadores de la misma.
/CTMUCPFKPFKECVKQPU
Marcas e indicaciones
As well as the electrical features, a series of indications
are printed on the ballasts which should be studied in order
to use them correctly, thus obtaining maximum electrical,
safety and duration possibilities.
En los productos de ELT, además de las características
eléctricas, se pueden encontrar impresas en su marcaje una
serie de indicaciones que conviene conocer para hacer el
uso adecuado de los mismos, obteniéndose así las máximas
prestaciones eléctricas, de seguridad y duración.
CVKQPCNEGTVKſECVKQPOCTMIKXGPD[C5RCPKUJEGTVKſ0
cation body.
CVKQPCNEGTVKſECVKQPOCTMIKXGPD[C)GTOCPEGTVKſ0
cation body
CTECPCEKQPCNFGEGTVKſECEKÎPEQPEGFKFCRQTWPQT/
ICPKUOQFGEGTVKſECEKÎPGP'URCÌC
V
CVKQPCNEGTVKſECVKQPOCTMIKXGPD[C+VCNKCPEGTVKſEC0
tion body
CVKQPCNEGTVKſECVKQPOCTMIKXGPD[C#TIGPVKPKCPEGT0
VKſECVKQPDQF[
CTECPCEKQPCNFGEGTVKſECEKÎPEQPEGFKFCRQTWPQT/
ICPKUOQFGEGTVKſECEKÎPGP#NGOCPKC
CTECPCEKQPCNFGEGTVKſECEKÎPEQPEGFKFCRQTWPQT/
ICPKUOQFGEGTVKſECEKÎPGP+VCNKC
IEC 61347-2-3
IEC 60929
CTECPCEKQPCNFGEGTVKſECEKÎPEQPEGFKFCRQTWPQT/
ICPKUOQFGEGTVKſECEKÎPGP#TIGPVKPC
CVKQPCNEGTVKſECVKQPOCTMIKXGPD[C5NQXCMKCPEGT0
VKſECVKQPDQF[
CTECPCEKQPCNFGEGTVKſECEKÎPEQPEGFKFCRQTWPQT/
ICPKUOQFGEGTVKſECEKÎPGP5NQXCMKC
GTVKſECVKQP OCTM ITCPVGF D[ CP QHſEKCN DQF[ YJKEJ
%
accredits the compliance with international regulations.
/CTEC FG EGTVKſECEKÎP QVQTICFC RQT WP QTICPKUOQ
QſEKCN SWG CETGFKVC GN EWORNKOKGPVQ EQP PQTOCU KPternacionales.
Mark indicating conformity with electromagnetic conHQTOKV[TGIWNCVKQPUITCPVGFD[CPQHſEKCNNCDQTCVQT[
Marca indicativa de conformidad con la normativa de
compatibilidad electromagnética otorgada por un laDQTCVQTKQQſEKCN
PGTI[GHſEKGPE[KPFGZ+PFGZQHVJGENCUUKſECVKQPQHDCN'
NCUVUHQTƀWQTGUEGPEGFGRGPFKPIQPVJGVQVCNRQYGTCDsorbed by the combined unit of the ballast and the lamp
in accordance with the European directive 2000/55/EC.
www.elt.es
EEI
269
PFKEGFGGſEKGPEKCGPGTIÃVKEC PFKEGFGENCUKſECEKÎP
FGNCUTGCEVCPEKCUFGƀWQTGUEGPEKC[FGUECTICUGIÕP
la potencia total absorbida por el conjunto balastolámpara según la Directiva Europea 2000/55/EC.
Mark which shows product conformity with European
directives.
Marca que declara la conformidad del producto con
las directivas europeas.
Maximum temperature allowed in the winding to guarantee the estimated average life expectancy of the
lamp.
tw
Temperatura máxima permitida en el bobinado para
garantizar la vida media estimada para la reactancia.
Maximum temperature allowed at the measuring point
indicated on the casing to ensure the correct operation of the ballast.
tc
Máxima temperatura admisible en el punto de medida
indicado en la envolvente para asegurar un correcto
funcionamiento de la reactancia.
Maximum environment temperature allowed in the
space where the ballast is located that must be respected to ensure correct operation.
ta
Temperatura ambiente máxima permitida en el habitáculo de la reactancia que debe respetarse para un
correcto funcionamiento.
Increase in temperature in the winding compared with
environment temperature in normal operation conditions.
ţV
Incremento de temperatura del bobinado sobre la
temperatura ambiente en condiciones normales de
funcionamiento.
Increase in temperature in the winding compared with
environment temperature in the capacitive system
(series capacitor) in normal conditions.
ţVcap
Incremento de temperatura del bobinado sobre la
temperatura ambiente en régimen capacitivo (condensador en serie) en condiciones normales.
Increase in temperature in the winding compared with
environment temperature with abnormal operation.
ţVan
Incremento de temperatura del bobinado sobre la
temperatura ambiente en funcionamiento anormal.
Power factor, indicator of the gap between the voltage
and current of an electrical circuit.
NJ
Factor de potencia, indicador del desfase entre la tensión y corriente de un circuito eléctrico.
Functional earth connection. Connection which unites
all parts which have to, out of necessity, be connected
to the earth due to different safety reasons.
Borne de conexión de tierra funcional. Borne al que
se unen las partes que necesariamente deben de
conectarse a tierra por razones diferentes de las de
seguridad.
Earth connection for protection against electrical discharges for Class I devices.
Borne de conexión de tierra de protección contra descargas eléctricas para dispositivos clase I.
Earth connection except exclusively functional or security connection.
Borne de conexión a tierra en caso de que ésta no
sea exclusivamente funcional o de seguridad.
Class II indication. Equipment protected against electrical discharges by basic insulation and other supplement or reinforcing. Does not incorporate earth connection protection.
Indicación de clase II. Dispositivo protegido contra
descargas eléctricas por un aislamiento básico y otro
suplementario o reforzado. No incorpora medios de
puesta a tierra de protección.
Equipment with reinforced insulation.
Aparato con aislamiento reforzado.
Class III indication. Device in which the protection
against electrical discharges rests in the supply to
Very Low Voltage for Security (MBTS). Does not incorporate earth connection protection.
Indicación de clase III. Dispositivo en el que la protección contra las descargas eléctricas descansa en
la alimentación a Muy Baja Tensión de Seguridad
(MBTS). No incorpora medios de puesta a tierra de
protección.
Indicative of the degree of protection against the penetration of solid bodies and accidental contact with
low voltage parts (1st no.), against the penetration of
water (2nd no.) and against impacts (3rd no.), in accordance with EN-60529. The larger the number, the
higher the degree of protection.
IP-XXX
Independent auxiliary device which can be separately
assembled on the outside of the luminaire without additional casing.
Indicativo del grado de protección contra la penetración de cuerpos sólidos y contactos accidentales con
las partes bajo tensión (1ª cifra), contra la penetración
de agua (2ª cifra) y contra impactos (3ª cifra), según
norma EN-60529. Cuanto mayor es la cifra, mayor es
el grado de protección.
Aparato auxiliar independiente que puede montarse
separadamente en el exterior de una luminaria y sin
envolvente adicional.
270
www.elt.es
Device which incorporates thermal protection with automatic resetting.
Dispositivo que incorpora protección térmica con
rearme automático.
Device which incorporates type PTC thermal protection.
Dispositivo que incorpora protección térmica tipo PTC.
Device which needs the external incorporation of a
wire fuse with the indicated value.
Dispositivo que necesita incorporar externamente un
fusible de hilo del valor indicado.
Primary.
PRI
Primario.
Secondary.
SEC
Secundario.
Safety transformer.
Transformador de seguridad.
Safety transformer not resistant to short-circuits.
Transformador de seguridad no resistente a los cortocircuitos.
Safety transformer resistant to short-circuits.
Transformador de seguridad resistente a los cortocircuitos.
GXKEGCRVHQTſVVGFCUUGODNKGUQTQPHWTPKVWTGOCFG
&
QH OCVGTKCN EQPUKFGTGF PQV VQ DG QT FKHſEWNV VQ DG KPƀCOOCDNG KP CEEQTFCPEG YKVJ TGIWNCVKQP &+0 Part 1.
Dispositivo apto para montaje encastrado o sobre
muebles, cuyos materiales sean considerados difícilOGPVG Q PQ KPƀCOCDNGU UGIÕP NC 0QTOC &+0 Parte 1.
Device that can be assembled on furniture made of
OCVGTKCN YJQUG ƀCOOCDKNKV[ KU WPMPQYP %QORNKGU
with temperature requirements of regulation VDE
0710 Part 14.
M
M
Dispositivo que puede montarse en muebles de cuyos materiales no se conocen sus características de
KPƀCOCDKNKFCF%WORNGEQPNQUTGSWKUKVQUFGVGORGTCtura de la norma VDE 0710 Parte 14.
Device protected against overheating. The number
indicated inside the triangle indicates the maximum
temperature at any point on the surface of the casing
in the case of a fault.
Dispositivo protegido contra sobre temperatura. El
número indicado en el interior del triángulo indica la
VGORGTCVWTCO¶ZKOCGPEWCNSWKGTRWPVQFGNCUWRGTſcie de la envolvente en caso de fallo del balasto.
Device that can be assembled on surfaces that are
PQTOCNN[KPƀCOOCDNG
KURQUKVKXQ SWG RWGFG OQPVCTUG UQDTG UWRGTſEKGU
&
PQTOCNOGPVGKPƀCOCDNGU
Safety extra-low voltage device.
SELV
Dispositivo de baja tensión de seguridad (Safety Extra-Low Voltaje).
Regulation with a cutting device at the beginning or
the end of the phase.
LC
GIWNCEKÎPEQPFKURQUKVKXQFGEQTVGCNKPKEKQQCNſPCN
4
de fase.
Regulation with a cutting device at the beginning of
the phase (Leading-edge dimming).
Regulation with a cutting device at the end of the
phases (Trailing-edge dimming).
L
C
GIWNCEKÎP EQP FKURQUKVKXQ FG EQTVG CN ſPCN FG HCUG
4
(Trailing-edge dimming).
Dispositivo para lámparas incandescentes.
Device for incandescent lamps.
www.elt.es
Regulación con dispositivo de corte al inicio de fase
(Leading-edge dimming).
271
3WCNKV[/CPCIGOGPV
Gestión de calidad
Since its foundation, ELT has contemplated the basic principals of Quality Management Systems. For this reason, the
development of principles of action based on reference regulations has been and currently is, an internal requirement
focused on increasing the value of our processes.
ELT desde su fundación, ha contemplado los principios
básicos de la Gestión de Sistemas de Calidad. Por tal motivo, el desarrollo de principios de actuación basados en normas de referencia ha sido y es en la actualidad, un requisito
interno enfocado a aumentar valor en nuestros procesos.
2005
%GTVKſGFD[#'014KPCEEQTFCPEGYKVJTGIWlation UNE-EN-ISO-9002:1994
%GTVKſGFD[#'014KPCEEQTFCPEGYKVJTGIWlation UNE-EN-ISO-9001:1994
%GTVKſGFD[#'014KPCEEQTFCPEGYKVJTGIWlation UNE-EN-ISO-14000:1996
%GTVKſGFD[#'014KPCEEQTFCPEGYKVJTGIWlation UNE-EN-ISO-9001:2000
Company management evaluation in accordance with the EFQM model.
2005
From the point of view of ensuring product conformity, ELT
has an implanted system which controls the purchased prodWEVUOCPWHCEVWTKPIRTQEGUUGUCPFVJGſPCNRTQFWEV
%
GTVKſECEKÎPRQT#'014FGCEWGTFQEQPNC
norma UNE-EN-ISO-9002:1994
%GTVKſECEKÎPRQT#'014FGCEWGTFQEQPNC
norma UNE-EN-ISO-9001:1994
%GTVKſECEKÎPRQT#'014FGCEWGTFQEQPNC
norma UNE-EN-ISO-14000:1996
%GTVKſECEKÎPRQT#'014FGCEWGTFQEQPNC
norma UNE-EN-ISO-9001:2000
Evaluación de la gestión de la empresa de
acuerdo con el modelo EFQM.
Desde el punto de vista del aseguramiento de la conformidad de los productos, ELT tiene implantado un sistema de
control de los productos de compra, procesos de fabricación
[RTQFWEVQſPCN
All raw materials go through an approval process based
on international regulations and, particularly, on our own criteria, built up as a result of years of experience. After this
process, all dispatches go through reception control to guarantee they meet approval requirements.
The inspection of the manufacturing process is continuous. The manufacturing technology allows us to establish,
automatically and in 100% of the products, different stages of
EQPVTQN
RTQEGUUCPFſPCNRTQFWEVKPYJKEJVJGHWPFCOGPVCN
electrical parameters are measured and recorded thus ensuring their correct operation. Samples from the laboratory
are periodically tested to ensure their suitability, as well as
to carry out the corresponding tests on the length of the life
of the product.
Todas la materias primas sufren un proceso de homologación interno, basado en normas internacionales y muy
especialmente, en criterios propios acumulados en años de
experiencia. Los ensayos son exhaustivos y deben superar
pruebas de campo. Posteriormente, todos los envíos se someten a control de recepción, para garantizar su adecuación
a los requisitos homologados.
La inspección del proceso de fabricación es continua. La
tecnología de fabricación nos permite establecer de forma
automática y al 100% de los productos fabricados, diferentes
GVCRCUFGEQPVTQN
RTQEGUQ[RTQFWEVQſPCNGPNCUSWGUG
miden y registran los parámetros eléctricos fundamentales,
que aseguran su correcto funcionamiento. Periódicamente,
se ensayan muestras en laboratorio para asegurar su idoneidad, además de realizar las correspondientes pruebas de
duración del producto.
'PXKTQPOGPVCNOCPCIGOGPV
Gestión Medioambiental
Protecting the environment is one of ELT’s most important
objectives and for this reason an Environmental Management System in accordance with regulation UNE-EN-ISO
14001 has been implanted in the factory. In this way, the
environment, together with innovation and quality, has become a basic objective.
La protección del Medio Ambiente es un objetivo prioritario para ELT y por esta razón se ha implantado en la factoría
un Sistema de Gestión Medioambiental de acuerdo con la
norma UNE-EN-ISO 14001.De esta forma el Medio Ambiente pasa a ser, junto con la Innovación y la Calidad un objetivo
básico.
As a company integrated in the Auxiliary Devices for Lighting sector, and as a result, as a socially responsible organisation, ELT commits itself to the protection of the environment and the prevention of contamination, and has established the following objectives:
~ The compliance with legal requirements.
~ The reduction of waste.
~ The reduction of emissions and noise.
~ The recycling and reuse of materials.
~ Optimising energy resources.
ELT como empresa integrante dentro del sector de fabricación de equipos auxiliares para iluminación, y por tanto,
como organización socialmente responsable, se compromete con la protección y prevención de la contaminación del
Medio Ambiente, estableciendo como objetivos:
~ El cumplimento con los requisitos legales.
~ La reducción de residuos.
~ La reducción de emisiones y ruido.
~ Reciclaje y reutilización de materiales
~ La optimización de los recursos energéticos.
This is possible thanks to the assignment of resources
which steers us towards continuous improvement, improvement in product design, process development, the acquisition of materials and services which exceed those of the
previous generation, and the establishment of collaboration
projects and supplier selection etc…
Esto es posible gracias a la asignación de recursos que
nos encaminen hacia la mejora continua, mejoras en el diseño de los productos, desarrollando procesos, y adquiriendo materiales y servicios que superen a los de generación
anterior y establecimiento de programas de colaboración y
selección de proveedores etc…
272
www.elt.es
www.elt.es
273
/CTMKPI
El Marcado
All electric and electronic appliances to be used within the
European Community must bear the CE mark, which stands
for “European Compliance” and denotes that they meet the
following EU Directives applicable to lighting products:
Para poder utilizar los aparatos eléctricos y electrónicos
en la Comunidad Europea, es obligatorio que sean portadoTGUFGNCOCTEC%'NCEWCNUKIPKſECő%QPHQTOKFCF'WTQRGCŒ
y representa el cumplimiento de las siguientes Directivas
Comunitarias a las que están sujetos los productos para iluminación.
2004/108/CE
Electromagnetic compatibility. Directive
of 15 December 2004.
2004/108/CE
2006/95/CE
Electrical equipment designed for low
voltage (LV) use: Directive of 12 December 2006.
2006/95/CE
2009/125/CE
2011/65/UE
2009/125/CE
Eco-design requirements for energyrelated products: Directive of 21 October
2009.
2011/65/CE
Restriction of the use of certain hazardous substances in electrical and electronic equipment (RoHS): Directive of 8
June 2011.
The CE mark is not awarded by any certifying body but
rather represents a declaration made by the actual manufacturer under its own liability as to the compliance of its products.
All ELT products bear the CE mark and the corresponding declarations of conformity thereto are available upon request; in consequence, luminaires bearing the CE mark are
equally guaranteed to comply with all legal requirements.
Compatibilidad Electromagnética. Directiva de 15 de diciembre de 2004.
Material eléctrico Baja Tensión. Directiva
de 12 de diciembre de 2006.
Diseño ecológico de productos relacionados con la energía. Directiva de 21 de
octubre de 2009.
Restricciones a la utilización de determinadas sustancias peligrosas en aparatos
eléctricos y electrónicos (RoHS). Directiva de 8 de junio de 2011.
'NOCTECFQ%'PQNQQVQTICPKPIWPCGPVKFCFFGEGTVKſECción, siendo el propio fabricante, bajo su responsabilidad, el
que realiza la declaracion de conformidad al respecto.
Todos los productos de ELT poseen el marcado CE, estando disponibles las correspondientes declaraciones de
conformidad, por lo que las luminarias que los incorporen
cumplirán con los requisitos legales.
6JG9'''CPF4Q*5&KTGEVKXGU
Las Directivas WEEE y RoHS
Environmental protection has become an important issue
in all walks of life. The rapid increase in the generation of
waste electrical and electronic equipment, and of the hazardous substances contained in it, is of growing concern. With
a view to solving the issue, two directives have so far been
approved by the European Parliament and European Commission, namely the WEEE and RoHS.
La protección del medio ambiente ha llegado a ser importante en todos los ámbitos de la vida. El rápido aumento de
los residuos de aparatos eléctricos y electrónicos, y las sustancias peligrosas que los mismos contienen, han causado
preocupación. Para solucionar el problema, el Parlamento
Europeo y la Comision Europea han aprobado dos directivas: WEEE y RoHS.
Directive 2012/19/EU of 4 July 2012 on waste electrical and electronic equipment (WEEE) aims to reduce the
amount of WEEE and to encourage its re-use, recycling and
other means of recovery that provide an overall reduction in
the amount of end waste. Likewise, it also strives to optimise
the capabilities of waste management enterprises.
La directiva 2012/19/CE de 4 de julio de 2012 WEEE
sobre residuos de aparatos eléctricos y electrónicos, tiene
como objetivo reducir los residuos de aparatos eléctricos y
electrónicos y promover la reutilización, el reciclado y otras
HQTOCUFGTGEWRGTCEKÎPEQPGNſPFGFKUOKPWKTNCGNKOKPCEKÎP
de tales residuos. A la vez se pretende optimizar la capacidad de las empresas que intervengan en el tratamiento de
los residuos.
Directive 2011/65/EU of 8 June 2011 on the restriction of
the use of certain hazardous substances in electrical and
electronic equipment (RoHS) requires that lead, mercury,
cadmium, hexavalent chrome, and a number of other substances be eliminated from electrical and electronic equipment.
La directiva 2011/65/CE del 8 de junio de 2011 (RoHS),
sobre restricciones a la utilización de determinadas sustancias peligrosas en aparatos eléctricos y electrónicos, indica
que el plomo, mercurio, cadmio, cromo hexavalente, y otras
sustancias se deben eliminar de aparatos eléctricos y electrónicos.
274
www.elt.es
ELT product warranty
Garantía para productos ELT
In keeping with its policy of product and service improvement, as of 1 January 2014, '.6 JCU FGEKFGF VQ GZVGPF
KVURTQFWEVYCTTCPV[VQſXG
[GCTU under the following
terms and conditions.
Siguiendo con la política de mejora de producto y de servicio, ELT ha decidido ampliar a partir del 1 de enero de
2014 la garantía estándar de sus productos a cinco (5)
años bajo las condiciones que se detallan más adelante.
ELT auxiliary lighting components are designed in accordance with current International Electrotechnical Commission (IEC) standards and are manufactured pursuant to the
most demanding quality criteria, based, among other things,
on ISO-9001 and ISO-14001 management standards. This
enables us to ensure and guarantee the great durability of
all our products.
Los componentes auxiliares para iluminación de ELT se
diseñan conforme a las normas CEI (Comisión Electrotécnica Internacional) vigentes y son fabricados bajo los más
exigentes criterios de calidad, basados, entre otras, en las
normas de gestión ISO-9001 e ISO-14001. Ello permite asegurar una gran durabilidad y garantía en todos los productos
de nuestra fabricación.
(KXG[GCTYCTTCPV[
All ELT brand products that fall under the following product
FGUETKRVKQPYKNNDGUWDLGEVVQVJGſXG[GCTYCTTCPV[
Garantía de 5 años:
La garantía de 5 años se concederá a todos los productos
con marca ELT que se encuentren en la siguiente descripción de producto:
~ Drivers or LED modules with a useful life of over 50,000
hours. LC and DLC models.
~ LED modules as long as they are connected to ELT
brand power sources. eLED models.
~ Electronic ballasts with a useful life of over 50,000 hours.
BE and DBE models.
~ Electronic and magnetic transformers for halogen lamps.
TCE, TR and LTC models.
`'NGEVTQOCIPGVKE DCNNCUVU HQT #% CPF #% ƀWQTGUEGPV
lamps.
~ Electromagnetic ballasts for HID lamps: VM, VS, VH,
HS, HM and HI models.
~ Discharge lamp ignitors. AVS and AH models.
~ Drivers para módulos LED con esperanza de vida superior a 50.000horas. Modelos LC y DLC.
~ Módulos LED siempre que se encuentren conectados
con fuentes de alimentación de marca ELT. Modelos
eLED.
~ Balastos electrónicos con una esperanza de vida superior a 50.000horas. Modelos BE y DBE.
~ Transformadores electrónicos y magnéticos para lámparas halógenas. Modelos TCE, TR y LTC.
`$CNCUVQU GNGEVTQOCIPÃVKEQU RCTC N¶ORCTCU ƀWQTGUcentes modelos AC1 y AC2.
~ Balastos electromagnéticos para lámparas HID:
Modelos VM, VS, VH, HS, HM y HI.
~ Arrancadores para lámparas de descarga. Modelo AVS
y AH.
~ Assemblies VSI-RASE, VS-2P and VM-2P.
~ Conjuntos montados VSI-RASE, VS-2P y VM-2P.
6JTGG[GCTYCTTCPV[
All ELT brand products that fall under the following product
description will be subject to the three-year warranty:
Garantía de 3 años:
La garantía de 3 años se concederá a todos los productos
que se encuentren en la siguiente descripción de producto:
~ Drivers or LED modules with a useful life of over 50,000
hours. FAV models.
~ Electronic ballasts with a useful life of over 50,000 hours.
DBE models.
~ Ballasts and drivers with a useful life of under 50,000
hours.
~ Capacitors.
~ Direct current powered ballasts CE model.
~ Emergency kits and their batteries.
~ Electronic starters.
~ Assemblies:
VS-ARCE, VS-C2 and VS-AF.
VH-ARCE, VH-C2 and VH-AF.
VM-C2 and VM-AF.
~ Products with IP67 grade protection (BE, LC, FAV, etc.).
~ Any product supplied with a brand other than the ELT
one.
~ Any other products not mentioned above.
~ Drivers para módulos LED con esperanza de vida superior a 50.000 horas. Modelos FAV.
~ Balastos electrónicos con una esperanza de vida superior a 50.000 horas. Modelos DBE.
~ Balastos y drivers con una esperanza de vida inferior a
50.000 horas.
~ Condensadores.
~ Balastos alimentados a tensión continua. Modelo CE.
~ Kits de emergencia y sus baterías.
~ Cebadores electrónicos.
~ Conjuntos montados:
VS-ARCE, VS-C2 y VS-AF.
VH-ARCE, VH-C2 y VH-AF.
VM-C2 y VM-AF.
~ Productos con grado de protección IP67 (BE, LC,
FAV…).
~ Cualquier producto suministrado con marca diferente a
ELT.
~ Resto de productos no mencionados anteriormente.
* The models of the VS, VH and VM ranges include both
versions of indoor VSI, VHI and VMI as well as outdoor VSE,
VHE and VME.
* Los modelos de las gamas VS, VH y VM contemplan
versiones tanto de interior VSI, VHI y VMI como de exterior
VSE, VHE y VME.
www.elt.es
275
9CTTCPV[EQPFKVKQPU
~ The warranty period begins as of the date of manufacture, attested to by the batch number marked on the product.
~ The warranty covers the replacement of the product and
replacement labour costs. Any other indirect costs that
may apply are not covered. (Documentation: “Application and maintenance recommendation for the use of
electronic ballasts in view of the directive 99/44/EC”
Celma – Lighting Europe http://www.lightingeurope.org)
~ ELT reserves the right to request the return of the faulty
product to its facilities at Zaragoza (Spain) to check and
NCVGTEQPſTOVJGTKIJVUWPFGTYCTTCPV[
~ The warranty solely covers material defects or manufacVWTKPI ƀCYU KP EQORQPGPVU OCPWHCEVWTGF CPF UWRRNKGF
by ELT.
ELT conditions the application of the warranty to compliance with the following requisites:
Condiciones de garantía:
~ El tiempo de la garantía comienza a partir de la fecha de
fabricación, de la que da fe el número de lote marcado
en el producto.
~ La garantía cubre la reposición del producto y costos de
mano de obra de reposición, no siendo responsable de
otros costos indirectos que se pudieran dar. (Documentación: “Application and maintenance recommendation
for the use of electronic ballasts in view of the directive
99/44/EC” Celma – LightingEurope http://www.lightingeurope.org)
~ ELT se reserva el derecho de solicitar la devolución del
producto afectado a sus instalaciones de Zaragoza (España) para la comprobación y posterior validación del
derecho de garantía.
~ La garantía cubre exclusivamente defectos en los materiales o fallos de fabricación en los componentes fabricados y suministrados por ELT.
ELT condiciona la aplicación de la garantía al cumplimiento de los siguientes apartados:
~ Functioning of the lighting system in accordance with the
applicable IEC international standards and the particular
URGEKſECVKQPUIKXGPD['.6+PUVTWEVKQPUOCPWCNUCXCKNCble at instructions manual on
www.elt.es/productos/inst_manual.html
~ Funcionamiento del sistema de iluminación de acuerdo
EQPNCPQTOCVKXCKPVGTPCEKQPCNCRNKECDNG+'%[GURGEKſcaciones particulares dadas por ELT. Existen manual de
instrucciones disponibles en
www.elt.es/productos/manual_instrucciones.html
~ Correcto uso, manipulación y almacenaje del producto
de forma que se garantice la ausencia de daños por terceros.
~ Correct use, handling and storage of the product so as to
guarantee the absence of damage by third parties.
9CTTCPV[ENCKOU where ELT is not liable for the defects or
faults CTGGZENWFGFWPFGTVJKUYCTTCPV[CPFURGEKſECNN[KP
CP[QHVJGHQNNQYKPIEKTEWOUVCPEGU
Quedan excluidas las reclamaciones de garantía en las
que ELT no es responsable de los defectos o fallos y, en
concreto, en cualquiera de los siguientes casos:
~ Mishandling, abuse or any type of fault for which the
customer or some third party is accountable, especially
in the event of not complying with the conditions of use
and installation stipulated by ELT, which are set forth in
our catalogue, product sheets and informative technical
documentation.
`/CKPUHCWNVUQTƀWEVWCVKQPU
~ Anomalous operating conditions.
`(QTEG OCLGWTG GIſTGƀQQFKPICEVUQHYCT XKQNGPEG
and vandalism, or similar situations.
~ Faults in any accessory or other component (even when
these are made or supplied by ELT) which are not part of
the components covered by this warranty.
~ Manipulación incorrecta, uso abusivo o cualquier tipo de
fallo atribuible al cliente o tercera parte, especialmente
en caso de no cumplimiento de las condiciones de inUVCNCEKÎP[WUQFGſPKFCURQT'.6SWGTGEQIGPPWGUVTQU
catálogos, hojas de producto y documentación técnica
divulgativa.
`(CNNQUQƀWEVWCEKQPGUGPGNUWOKPKUVTQGNÃEVTKEQ
~ Condiciones anómalas de funcionamiento.
~ Fuerza Mayor, como por ejemplo: fuego, inundaciones,
actos de guerra, de violencia o vandálicos o situaciones
similares.
~ Fallos de cualquier accesorio u otros componentes (incluso caso que fueran fabricados o suministrados por
ELT) que no sean parte de los componentes cubiertos
por esta garantía.
~ Intento de cambio o mantenimiento del componente por
cualquier persona, que no sea instalador autorizado.
~ Que el componente tenga su número de lote dañado,
cambiado o borrado.
~ An attempt to change or service a component by any
RGTUQPQVJGTVJCPCPCWVJQTKUGFſVVGT
~ When the component’s batch number is damaged, changed or erased.
Legal warranty rights that apply to our products remain intact with respect to this warranty and remain independently
good.
Los derechos de garantía legales que sean de aplicación a
nuestros productos no varían con motivo de esta garantía y
continúan siendo válidos de forma independiente.
'.6TGUGTXGUVJGTKIJVVQVCMGCP[ſPCNFGEKUKQPCUTGICTFU
a warranty claim and undertakes to manage claims swiftly,
fully and honestly whatever the claim.
'.6UGTGUGTXCGNFGTGEJQRCTCVQOCTNCFGEKUKÎPſPCNFG
cualquier reclamación de garantía y se compromete a gesVKQPCT T¶RKFCOGPVG [ FG HQTOC EQORNGVC ſCDNG [ JQPGUVC
cualquier reclamación.
ELT reserves the right to modify these terms and conditions for future warranties without prior notice.
'.6UGTGUGTXCGNFGTGEJQFGOQFKſECTGUVCUEQPFKEKQPGU
y términos para futuras garantías, sin previo aviso.
276
www.elt.es
Packaging, unit net weight and pallet conditioning of ELT products
(PEDODMHSHVRXQLWDULRQHWR\DFRQGLFLRQDPLHQWRSRUSDOHWGH
productos ELT
Model
Ref. No.
Modelo
0GVWPKV
YGKIJV
7PKVURGT
DQZ
7PKVURGT
pallet
Pallet
FKOGPUKQP
7PKVURGT
pallet
Pallet
FKOGPUKQP
Peso neto
unitario
Unidades
por caja
Unidades
por palet
Dimensiones
del palet
Unidades
por palet
Dimensiones
del palet
1111010
AC1 09/22-SP-2 5,7,9,11W.220V.C.RA
0,318
40
3080
750x1000
1111140
AC1 13/22-SP-2
10,13W.220V.C.RA
0,325
40
3080
750x1000
1111160
AC1 16/22-SP-2
16W.220V.C.RA
0,325
40
3080
750x1000
1111290
AC1 2/12-SP-2 20W.125V.C.TOR.50Hz
0,325
40
3080
750x1000
1111310
AC1 04/22 SP-2
0,325
40
3080
750x1000
1111360
AC1 09/22-SP-2 5,7,9,11W.220V.C.TO
0,318
40
3080
750x1000
1111370
AC1 13/22-SP-2
0,325
40
3080
750x1000
1111470
AC1 04/23-SP
4,6,8W.230V.C.RA
0,322
40
3080
750x1000
1111471
AC1 04/23-SP
4,6,8W 230V C.TO
0,322
40
3080
750x1000
1111623
AC1 18/24-D-SC-1 18W 240V C.RAP(45)
0,415
30
2640
750x1000
1111632
AC1 18/23-D-SC-1 18W 230V RAP.(45)
0,40
30
2640
750x1000
1111633
AC1 18/23-D-SC-1 18W 230V C.TOR(45)
0,415
30
2640
750x1000
1111650
AC1 09/23-SP
5,7,9,11W.230V.C.RA
0,322
40
3080
750x1000
1111652
AC1 09/23-SP
5,7,9,11W 230V C.TO
0,325
40
3080
750x1000
1111670
AC1 13/23-SP
10,13W.230V.C.RA
0,320
40
3080
750x1000
1111671
AC1 13/23-SP
10,13W 230V C.TO
0,325
40
3080
750x1000
1111730
AC1 16/23-SP 16W 230V 50Hz FR
0,320
40
3080
750x1000
1111731
AC1 16/23-SP 16W 230V C.TOR.
0,325
40
3080
750x1000
1111760
AC1 16/22-SP-2
0,325
40
3080
750x1000
1111780
AC1 04/24-SP
4,6,8W.240V.C.RA
0,325
40
3080
750x1000
1111790
AC1 09/24-SP
5,7,9,11W.240V.C.RA
0,325
40
3080
750x1000
1111800
AC1 13/24-SP
10,13W.240V.C.RA
0,325
40
3080
750x1000
1111801
AC1 13/24-SP
10,13W.240V.C.TO
0,325
40
3080
750x1000
1111870
AC1 04/12-SP-2 4-6-8W 125V 50Hz FR
0,325
40
3080
750x1000
1111890
AC1 16/24-SP 16W 240V C.RAPIDA
0,325
40
3080
750x1000
1112493
AC1 4/24-B2-SC 40W 240V C.TOR.
0,547
30
1920
750x1000
1890
800x1000
1112530
AC1 15/23-SC
0,555
30
1920
750x1000
1890
800x1000
4,6,8W.220V.C.RA
10,13W.220V.C.TO
16W.220V.C.TO
15W.230V.C.RAPIDA
1112550
AC1 25/23-SC
25W 230V C.RAPIDA
0,555
30
1920
750x1000
1890
800x1000
1112560
AC1 3/23-SC
30W.230V.C.RAPIDA
0,556
30
1920
750x1000
1890
800x1000
1112572
AC1 32/23-B2-SC 32W 230V C.RAP.
0,566
30
1920
750x1000
1890
800x1000
1112573
AC1 32/23-B2-SC 32W 230V C.TOR.
0,567
30
1920
750x1000
1890
800x1000
1112600
AC1 15/23-SC
15W 230V C.TORNILLO
0,556
30
1920
750x1000
1890
800x1000
1112620
AC1 25/23-SC
25W 230V C.TORNILLO
0,555
30
1920
750x1000
1890
800x1000
1112670
AC1 15/22-SC-2 15W 220V C.RAPIDA
0,547
30
1920
750x1000
1890
800x1000
1112680
AC1 2/22-SC-2 20W.220V.C.RAPIDA
0,547
30
1920
750x1000
1890
800x1000
800x1000
1112690
AC1 25/22-SC-2 25W 220V C.RAPIDA
0,547
30
1920
750x1000
1890
1112700
AC1 3/22-SC-2 30W 220V C.RAPIDA
0,547
30
1920
750x1000
1890
800x1000
1112710
AC1 32/22-SC-2 32W 220V C.RAPIDA
0,547
30
1920
750x1000
1890
800x1000
1112720
AC1 4/22-SC-2 40W.220V.C.RAPIDA
0,547
30
1920
750x1000
1890
800x1000
1112740
AC1 15/22-SC-2 15W 220V C.TORNILLO
0,547
30
1920
750x1000
1890
800x1000
1112750
AC1 2/22-SC-2 20W.220V.C.TORNILLO
0,547
30
1920
750x1000
1890
800x1000
1112770
AC1 3/22-SC-2 30W 220V C.TORNILLO
0,547
30
1920
750x1000
1890
800x1000
1112780
AC1 32/22-SC-2 32W 220V C.TORNILLO
0,547
30
1920
750x1000
1890
800x1000
1112790
AC1 4/22-SC-2 40W.220V.C.TORNILLO
0,547
30
1920
750x1000
1890
800x1000
1112860
AC1 2/23-BP-SC 20W 230V C.RAPIDA
0,804
30
1120
750x1000
1112870
AC1 4/23-BP-SC 40W 230V C.RAPIDA
0,807
30
1120
750x1000
1112890
AC1 15/24-SC
0,547
30
1920
750x1000
1890
800x1000
1112891
AC1 15/24-SC 15W 240V C.TORNILLO
0,547
30
1920
750x1000
1890
800x1000
15W 240V C.RAPIDA
1112910
AC1 25/24-SC
25W 240V C.RAPIDA
0,547
30
1920
750x1000
1890
800x1000
1112920
AC1 3/24-SC
30W.240V C.RAPIDA
0,559
30
1920
750x1000
1890
800x1000
30W 240V C.TORNILLO
1112923
AC1 3/24-SC
0,547
30
1920
750x1000
1890
800x1000
1112931
AC1 32/24-B2-SC 32W 240V C. TORNILLO
0,566
30
1920
750x1000
1890
800x1000
1112950
AC1 6/22-SC
65W 220V C.RAPIDA
0,825
20
1320
750x1000
1112952
AC1 6/22-SC
65W 220V C.TORNILLO
0,825
20
1320
750x1000
1113046
AC1 2/24-B2-SC 20W 240V C.TOR.
0,547
30
1920
750x1000
1890
800x1000
1113050
AC1 2/23-B2-SC 20W 230V C.RAP.
0,563
30
1920
750x1000
1890
800x1000
1113055
AC1 2/23-B2-SC 20W 230V C.TOR
0,563
30
1920
750x1000
1890
800x1000
1113057
AC1 2/24-B2-SC 20W 240V C.RAP.
0,566
30
1920
750x1000
1890
800x1000
800x1200
1113059
AC1 2/23-B2-SC 20W 230V C.RAP.FLEJ
0,566
10
2000
750x1000
1820
1113060
AC1 4/23-B2-SC 40W 230V C.RAP.
0,568
30
1920
750x1000
1890
800x1000
1113065
AC1 4/23-B2-SC 40W 230V C.TOR.
0,568
30
1920
750x1000
1890
800x1000
1113066
AC1 4/23-B2-SC 40W 230V C.RAP.FLEJ
0,568
10
2000
750x1000
1820
800x1200
1113069
AC1 4/24-B2-SC 40W 240V C.RAP.
0,568
30
1920
750x1000
1890
800x1000
1113072
AC1 6/23-B2-SC 65W 230V C.RAP
0,890
20
1320
750x1000
278
www.elt.es
Packaging, unit net weight and pallet conditioning of ELT products
Embalaje, peso unitario neto y acondicionamiento por palet de
productos ELT
Model
Ref. No.
Modelo
Net unit
weight
Units per
box
Units per
pallet
Pallet
dimension
Units per
pallet
Pallet
dimension
Peso neto
unitario
Unidades
por caja
Unidades
por palet
Dimensiones
del palet
Unidades
por palet
Dimensiones
del palet
1113073
AC1 6/23-B2-SC 65W 230V C.TOR.
0,890
20
1320
750x1000
1113074
AC1 6/23-B2-SC 65W 230V C.RAP.FLEJ
0,890
10
1260
800x1200
1113078
AC1 6/24-B2-SC 65W 240V C.RAP
0,889
20
1320
750x1000
1113079
AC1 6/24-B2-SC 65W 240V C.TOR
0,890
20
1320
750x1000
1113101
AC1 26/24-SC C.RAPIDA AGU.2mm.
0,486
30
2640
750x1000
1113102
AC1 26/23-SC 24-26W 230V 50Hz C.TO
0,483
30
2640
750x1000
1113103
AC1 26/23-SC C.RAPIDA AGUJERO.2mm
0,486
30
2640
750x1000
1113104
AC1 26/24-SC 24-26W 240V 50Hz C.TO
0,487
30
2640
750x1000
1113106
AC1 26/22-SC
0,480
30
2640
750x1000
1113107
AC1 26/22-SC 24-26W 220V 50Hz C.TO
0,484
30
2640
750x1000
1115990
AC1 4/12-4
1116090
AC1 16/22-SP-2 16W.220V.C.TOR.60Hz
1116140
AC1 09/22-SP-2 9W.220V.C.TOR.60Hz
0,325
40
3080
750x1000
1116155
AC1 18/22-D-SC-6 18W220V60HCR(45)
0,415
30
2640
750x1000
1116158
AC1 18/22-D-SC-6 18W220V60HCT(45)
0,415
30
2640
750x1000
1116250
AC1 04/22-SP-2 4,6,8W 220VCT 60Hz
0,325
40
3080
750x1000
1116252
AC1 04/22-SP-2 4,6,8W 220VCR 60Hz
0,325
40
3080
750x1000
1116340
AC1 15/22-SC-26 15W 220V C.RAP.60Hz
0,547
30
1920
750x1000
1890
800x1000
1116350
AC1 2/22-SC-26 20W 220V C.RAP.60Hz
0,547
30
1920
750x1000
1890
800x1000
26W 220V C.RA
40W 125V 50Hz BF
1,127
20
980
750x1000
0,325
40
3080
750x1000
1116360
AC1 25/22-SC-26 25W 220V 60Hz CR
0,547
30
1920
750x1000
1890
800x1000
1116370
AC1 3/22-SC-26 30W 220V C.RAP.60Hz
0,544
30
1920
750x1000
1890
800x1000
1116380
AC1 32/22-SC-26 32W 220V C.RAP.60Hz
0,547
30
1920
750x1000
1890
800x1000
1116381
AC1 32/22-SC-26 32W 220V C.TOR.60Hz
0,547
30
1920
750x1000
1890
800x1000
1116390
AC1 4/22-SC-26 40W 220V C.RAP.60Hz
0,548
30
1920
750x1000
1890
800x1000
1116400
AC1 2/22-SC-26 20W 220V C.TOR.60Hz
0,547
30
1920
750x1000
1890
800x1000
1116410
AC1 15/22-SC-26 15W 220V C.TOR.60Hz
0,547
30
1920
750x1000
1890
800x1000
1116420
AC1 3/22-SC-26 30W 220V C.TOR.60Hz
0,547
30
1920
750x1000
1890
800x1000
1890
800x1000
1116460
AC1 4/22-SC-26 40W 220V C.TOR.60Hz
0,554
30
1920
750x1000
1116780
AC1 13/22-SP-2 13W.220V.C.TOR.60Hz
0,325
40
3080
750x1000
1116900
AC1 09/22-SP-2 9-11W 220V 60Hz FR
0,325
40
3080
750x1000
1116990
AC1 13/22-SP-2 13W.220V.C.RAP.60Hz
0,325
40
3080
750x1000
1120010
AC2 2/23-B1-SC-3 2x20W 230V C.RAP.
0,494
30
1920
750x1000
1890
800x1000
1120011
AC2 2/23-B1-SC-3 2x20W 230V C.TOR
0,510
30
1920
750x1000
1890
800x1000
3110010
CEBADOR ELECTRONICO AF1 001 200V.
0,090
50
3110030
CEBADOR ELECTRONICO AF1-0032 110V.
0,080
50
3110040
CEBADOR ELECTRONICO AF1-004 13W.
0,080
50
3110050
CEBADOR ELECTRONICO AF1-003 110V..
0,080
50
3110060
CEBADOR ELECTRONICO AF1-005 200V.
0,010
360
3110070
CEBADOR ELECTRONICO AF1-006 110V
0,010
360
3210111
ARRANCADOR AVS-100-DP (Cables)
0,039
30
3150
750x1000
3210112
ARRANCADOR AVS-100-D (Bornes)
0,041
30
3150
750x1000
3210113
ARRANCADOR AVS-100-D (Cables)
0,037
30
3150
750x1000
3210131
ARRANCADOR AH-002-D (Bornes)
0,034
30
3150
750x1000
3210132
ARRANCADOR AH-002-D (Cables)
0,041
30
3150
750x1000
3210191
ARRANCADOR AH-005/380-DP 380-415V
0,054
25
2100
750x1000
3210211
ARRANCADOR AVS 1000 VSyHM 600-1000W
0,314
20
1800
750x1000
3210212
ARRANCADOR AH 1000
0,310
20
1800
750x1000
3210232
ARRANCADOR AVS-400-D
0,170
30
3150
750x1000
3210233
ARRANCADOR AVS-400-DP
0,170
30
3150
750x1000
3210241
ARRANCADOR AVS 2000/380
0,290
20
1800
750x1000
3210251
ARRANCADOR AH 2000/220
0,907
10
456
750x1000
3210442
ARRANCADOR AVS-100-DP (Bornes)
0,041
30
3150
750x1000
HM 1000W
HM 2000W
HM 2000W
3211053
ARRANCADOR AVS-100-DP-40 (Cables)
0,039
30
3150
750x1000
3211054
ARRANCADOR AVS-100-DP-40 (Bornes)
0,034
30
3150
750x1000
0,047
30
3150
750x1000
2,60
6
288
750x1000
750x1000
3512001
ITP 277-8KA
5110370
VME 25/22-EA 250W.220V.
VM
5110380
VME 40/22-EA 400W.220V.
VM y HM
3,70
5
240
5110390
VME 25/23-EA 250W 230V
VM
2,803
6
288
750x1000
5110400
VME 40/23-EA 400W 230V
VM y HM
3,824
5
240
750x1000
5112120
VMI 8/22-2 80W.220V.
1,230
10
960
750x1000
5112150
VMI 40/22-2 400W 220V
3,450
5
350
750x1000
VM
VM y HM
5112200
VMI 40/23-SC 400W 230V
2,945
8
352
750x1000
384
800x1200
5112201
VMI 40/24-SC 400W 240V 50Hz
2,906
8
352
750x1000
384
800x1200
5112202
VMI 40/22-SC 400W 220V 50Hz
2,947
8
352
750x1000
384
800x1200
www.elt.es
VM y HM
279
Packaging, unit net weight and pallet conditioning of ELT products
(PEDODMHSHVRXQLWDULRQHWR\DFRQGLFLRQDPLHQWRSRUSDOHWGH
productos ELT
Model
Ref. No.
Modelo
5112203
VMI 40/23-SC-P 400W 230V
5112250
VMI 25/24-3 250W.240V.
5112251
5112260
5112261
C/TER
0GVWPKV
YGKIJV
7PKVURGT
DQZ
7PKVURGT
pallet
Pallet
FKOGPUKQP
7PKVURGT
pallet
Pallet
FKOGPUKQP
Peso neto
unitario
Unidades
por caja
Unidades
por palet
Dimensiones
del palet
Unidades
por palet
Dimensiones
del palet
384
800x1200
2,950
8
352
750x1000
2,425
5
440
750x1000
VMI 25/24-3-P 250W 240V 50Hz C/TER
2,526
5
350
750x1000
VMI 40/24-2 400W.240V.
3,450
5
350
750x1000
VMI 40/24-2-P 400W 240V 50Hz C/TER
3,465
5
350
750x1000
5112290
VMI 25/22-3 250W.220V.
VM
2,445
5
440
750x1000
5112300
VMI 12/22-3 125W.220V.
VM
1,253
10
960
750x1000
5112342
VMI 100/24-4
5112400
VMI 12/23-3 125W.230V.
5112410
5112411
VM
VM y HM
1000W 240V
VM
9,045
2
100
750x1000
1,268
10
960
750x1000
VMI 25/23-3 250W.230V.VM-HM(2,10A)
2,452
5
440
750x1000
VMI 25/23-3-P 250W 230V 50Hz C/TER
2,425
5
440
750x1000
5112424
VMI 40/23-3 400W 230V
3,480
5
350
750x1000
5112425
VMI 40/23-3-P 400W 230V 50Hz C/TER
3,450
5
350
750x1000
5112430
VMI 8/23-2 80W.230V.
5112440
VMI 12/24-3 125W.240V.
5112450
VMI 8/24-2 80W.240V.
5112530
VMI 5/24-2 50W.240V.
5112550
VMI 5/23-2 50W.230V.
5112570
VMI 70/23-3 700W.230V
5112571
VMI 70/24-3 700W.240V.
5112580
VMI 100/23-4
1000W 230V
VM
5112581
VMI 100/22-5
1000W 220V
VM
5112680
VMI 25/23-SC
5112681
5112682
VM
VM y HM
VM
1,210
10
960
750x1000
1,270
10
960
750x1000
VM
1,230
10
960
750x1000
VM
1,200
10
960
750x1000
VM
1,200
10
960
750x1000
VM
6,383
3
180
750x1000
VM
6,250
3
180
750x1000
9,045
2
100
750x1000
9,340
2
100
750x1000
2,060
10
600
750x1000
VMI 25/23-SC-P 250W 230V 50Hz
2,060
10
600
750x1000
VMI 25/22-SC
250W 220V 50Hz
2,046
10
600
750x1000
5112683
VMI 25/24-SC
250W 240V 50Hz
2,060
10
600
750x1000
5113520
VMI 5/22-2 50W.220V60Hz. VM
1,200
10
960
750x1000
5113530
VMI 8/22-2 80W.220V60Hz. VM
1,170
10
960
750x1000
5113670
VMI 40/22-26 400W.220V.60Hz.VM y HM
3,387
5
350
750x1000
5113770
VMI 12/22-3 125W.220V60Hz. VM
1,270
10
960
750x1000
5113780
VMI 25/22-3 250W.220V.60Hz. VM
2,425
5
440
750x1000
5113980
VMI 100/22-4
6,250
2
100
750x1000
5113990
VMI 70/22-3 700W.220V.60Hz VM
6,250
3
180
750x1000
5114500
VMI 8/23-2P-RME-A
5114501
VMI 8/23-2P-RME-SM 80W 230V 50Hz
5114510
VMI 12/23-2P-RME-A 125W 230V 50Hz
1,793
7
343
750x1000
5114511
VMI 12/23-2P-RME-SM 125W 230V 50Hz
1,770
7
343
750x1000
5114520
VMI 25/23-2P-RME-A 250W 230V 50Hz
2,655
5
245
750x1000
5114521
VMI 25/23-2P-RME-SM 250W 230V 50Hz
2,660
5
245
750x1000
VM
250W 230V 50Hz
1000W 220V VM 60Hz
80W 230V 50Hz
1,360
7
343
750x1000
1,460
7
343
750x1000
5114530
VMI 40/23-2P-RME-A 400W 230V 50Hz
3,550
5
245
750x1000
5114531
VMI 40/23-2P-RME-SM 400W 230V 50Hz
3,720
5
245
750x1000
5210270
VME 25/23-C2-AF 250W 230V VM
3,100
4
100
750x1000
5210280
VME 40/23-C2-AF 400W 230V VM
4,160
4
100
750x1000
5210290
VME 8/23-C2-AF 80W 230V VM
1,780
8
360
750x1000
5210300
VME 12/23-C2-AF 125W 230V VM
1,807
8
360
750x1000
5211510
VMI 8/23-C2
5211520
VMI 8/23-C2S
80W 230V VM
5211530
VMI 12/23-C2
125W 230V VM
5211540
VMI 12/23-C2S
5211550
VMI 25/23-C2
5211560
VMI 25/23-C2S-AF 250W 230V 50Hz VM
5211570
VMI 40/23-C2
5211580
VMI 40/23-C2S-AF 400W 230V 50Hz VM
5218140
VME 8/23-2P-C2-AF
5218150
VME 12/23-2P-C2-AF 125W 230V
5218160
VME 25/23-2P-C2-AF 250W 230V
3,250
4
100
750x1000
5218161
VME 25/23-2P-C2-AF-SM 250W 230V VM
3,110
4
100
750x1000
5218170
VME 40/23-2P-C2-AF 400W 230V
3,950
4
100
750x1000
5218171
VME 40/23-2P-C2-AF-SM 400W 230V
3,950
4
100
750x1000
5218180
VME 12/23-2P-C2-AF-SM 125W 230V VM
3,110
4
100
750x1000
5218190
VME 8/23-2P-C2-AF-SM 80W 230V VM
1,635
8
360
750x1000
5612563
VMI 25/23-3-AF-002 HALOG.50Hz
2,800
5
250
750x1000
6110170
VSE 10/22-EA 100W 220V VSAP y HM
1,900
10
500
750x1000
6110173
VSE 10/22-3T-B 100W 230V VSAP y HM
1,889
10
500
750x1000
80W 230V VM
125W 230V VM
250W 230V VM
400W 230V VM
80W 230V VM
1,635
8
360
750x1000
1,635
8
360
750x1000
1,635
8
360
750x1000
1,635
8
360
750x1000
3,110
4
100
750x1000
3,110
4
100
750x1000
4,100
4
100
750x1000
4,230
4
100
750x1000
1,800
8
360
750x1000
2,135
8
360
750x1000
280
www.elt.es
Packaging, unit net weight and pallet conditioning of ELT products
(PEDODMHSHVRXQLWDULRQHWR\DFRQGLFLRQDPLHQWRSRUSDOHWGH
productos ELT
Model
Ref. No.
Modelo
0GVWPKV
YGKIJV
7PKVURGT
DQZ
7PKVURGT
pallet
Pallet
FKOGPUKQP
7PKVURGT
pallet
Pallet
FKOGPUKQP
Peso neto
unitario
Unidades
por caja
Unidades
por palet
Dimensiones
del palet
Unidades
por palet
Dimensiones
del palet
6110193
VSE 5/22-3T-D 50W 230V VSAP y HM
1,510
10
500
750x1000
6110330
VSE 7/22-3T-E 70W 220V VSAP y HM
1,510
10
500
750x1000
6110340
VSE 7/22-3T-D 70W 230V VSAP y HM
1,413
10
500
750x1000
6110350
VSE 25/22-3T-E 250W 220V VSAP y HM
3,700
5
240
750x1000
6110360
VSE 15/22-3T-E 150W 220V VSAP y HM
2,600
6
288
750x1000
6110370
VSE 40/22-3T-E 400W 220V VSAP
5,000
4
192
750x1000
6110390
VSE 15/22-3T-D 150W 230V VSAP y HM
2,395
6
288
750x1000
6110400
VSE 25/22-3T-D 250W 230V VSAP y HM
3,700
5
240
750x1000
6110410
VSE 40/22-3T-D 400W 230V VSAP y HM
5,000
4
192
750x1000
6111510
VSI 7/22-3T-G
1,269
10
960
750x1000
6111520
VSI 10/22-3T-G 100W240V VSAPyHM
1,700
10
700
750x1000
6111525
VSI 10/22-3T-G-P 100W240V50Hz C/TER
1,697
10
700
750x1000
6111530
VSI 15/22-3T-G 150W240V VSAPyHM
2,095
5
440
750x1000
6111540
VSI 25/22-3T-G 250W240V VSAPyHM
3,479
5
350
750x1000
6111541
VSI 25/22-3T-G-P 250W240V50Hz C/TER
3,465
5
350
750x1000
6111550
VSI 40/22-3T-G 400W240V VSAP
4,767
5
245
750x1000
6111551
VSI 40/23-3T-G 400W240V VSAP 4,6A
4,775
5
245
750x1000
240
800x1200
6111552
VSI 40/22-3T-G-P 400W240V50Hz C/TER
4,775
5
245
750x1000
240
800x1200
6111560
VSI 7/22-3T-G-P 70W240V50Hz C/TER
1,264
10
960
750x1000
6111570
VSI 15/22-3T-G-P 150W240V50Hz C/TER
2,095
5
440
750x1000
6112040
VSI 7/22-3T-D
1,243
10
960
750x1000
6112044
VSI 7/22-3T-D-P 70W230V50Hz C/TER
1,266
10
960
750x1000
6112047
VHI 7/22-3T-D 3-4,5kV 70WHgI
1,270
10
960
750x1000
6112049
VHI 7/22-3T-D-P 70W 230V HM 4,5KV
1,263
10
960
750x1000
6112140
VSI 10/22-2
1,700
10
700
750x1000
6112145
VSI 10/22-2-P
1,700
10
700
750x1000
6112180
VSI 10/22-3T-B 100W230V VSAPyHM
1,679
10
700
750x1000
6112182
VSI 10/22-3T-B-P 100W230V50Hz C/TER
1,671
10
700
750x1000
70W240V VSAPyHM
70W230V VSAPyHM
100W220V VSAPyHM
100W220V5OHz
6112215
VSI 25/3T-D-SC 250W 230V
6112216
VSI 25/3T-E-SC 250W 220V VSyHM
VSyHM
6112217
VSI 25/3T-G-SC 250W 240V
6112221
VSI 25/3T-D-SC-P 250W230V50Hz
VSyHM
2,927
8
352
750x1000
384
800x1200
2,910
8
352
750x1000
384
800x1200
2,935
8
352
750x1000
384
800x1200
2,923
8
352
750x1000
384
800x1200
384
800x1200
6112222
VSI 25/3TG-SC-P
250W 240V 50Hz
2,952
8
352
750x1000
6112262
VHI 100/23-3
1000W 230V HPI-MAIH
9,245
2
100
750x1000
6112265
VHI 100/23-4
1000W 230V HPI-MAHI
9,350
2
100
750x1000
6112291
VSI 100/3T-D 1.000W 230V50Hz VSyHM
9,420
2
100
750x1000
6112292
VSI 100/3T-G 1.000W 240V 50Hz
9,420
2
100
750x1000
6112293
VSI 100/3T-E 1.000W 220V 50Hz
9,350
2
100
750x1000
6112302
VHI 200/40-41-8 2000W 400-415V12,2A
16,70
1
50
750x1000
6112315
VSI 15/22-3T-E-P 150W220V50Hz C/TER
2,095
5
440
750x1000
6112330
VSI 15/22-3T-E 150W220V VSAPyHM
2,095
5
440
750x1000
6112340
VSI 15/22-3T-D 150W230V VSAPyHM
2,082
5
440
750x1000
6112350
VSI 25/22-3T-D 250W230V VSAPyHM
3,448
5
350
750x1000
6112360
VSI 40/22-3T-D 400W230V VSAP
4,721
5
245
750x1000
240
800x1200
6112361
VSI 40/23-3T-D 400W230V VS-HM(4,6A)
4,775
5
245
750x1000
240
800x1200
6112363
VSI 40/22-3T-D-P 400W230V50Hz C/TER
4,754
5
245
750x1000
240
800x1200
6112365
VSI 40/23-3T-G-P 400W240V 4,6A
4,775
5
245
750x1000
240
800x1200
240
800x1200
6112366
VSI 40/23-3T-D-P 400W230V 4,6A
4,777
5
245
750x1000
6112401
VSI 60/3T-D
6,250
3
180
750x1000
6112402
VSI 60/3T-D-P
6,418
3
180
750x1000
6112406
VSI 60/3T-E 600W 220V 50Hz VSAP
6,250
3
180
750x1000
6112407
VSI 60/3T-G-P
6,250
3
180
750x1000
6112410
VSI 5/22-2
1,270
10
960
750x1000
6112421
VSI 5/22-3T-D
1,239
10
960
750x1000
600W 230V
VSAP
600W230V VSAP C/TE
600W240V VSAP C/TE
50W220V VSAPyHM
50W230V50Hz
6112422
VSI 5/22-3T-D-P 50W230V50Hz
1,244
10
960
750x1000
6112460
VSI 25/22-3T-D-P 250W230V50Hz C/TER
3,457
5
350
750x1000
6112470
VSI 15/22-3T-D-P 150W230V50Hz C/TER
2,095
5
440
750x1000
6112490
VSI 15/3T-D-SC-P 150W 230V
C/TER
2,040
10
600
750x1000
6112491
VSI 15/3T-D-SC 150W 230V
VSyHM
2,060
10
600
750x1000
6112500
VSI 15/3T-E-SC 150W 220V
VSyHM
2,028
10
600
750x1000
6112501
VSI 15/3T-E-SC-P 150W 220V
2,028
10
600
750x1000
6112504
VSI 15/3T-G-SC 150W 240V
2,060
10
600
750x1000
6112505
VSI 15/3T-G-SC-P 150W240V50Hz C/TER
2,038
10
600
750x1000
6112561
VHI 3/22-3 35W 220V 50Hz
1,230
10
960
750x1000
www.elt.es
VSyHM C/T
VSyHM
281
Packaging, unit net weight and pallet conditioning of ELT products
(PEDODMHSHVRXQLWDULRQHWR\DFRQGLFLRQDPLHQWRSRUSDOHWGH
productos ELT
Model
Ref. No.
Modelo
0GVWPKV
YGKIJV
7PKVURGT
DQZ
7PKVURGT
pallet
Pallet
FKOGPUKQP
7PKVURGT
pallet
Pallet
FKOGPUKQP
Peso neto
unitario
Unidades
por caja
Unidades
por palet
Dimensiones
del palet
Unidades
por palet
Dimensiones
del palet
6112562
VHI 3/23-3 35W 230V 50Hz VH
1,218
10
960
750x1000
6112563
VHI 3/23-3-P 35W230V50Hz VH C/TER
1,217
10
960
750x1000
6112572
VHI 3/24-3 35W 240V 50Hz VH
1,230
10
960
750x1000
6112573
VHI 3/24-3-P 35W240V50Hz
1,230
10
960
750x1000
6112601
VSI 60/3T-E-P
6,400
3
180
750x1000
6112622
VHI 7/22-3T-G 70W 240V HM 4,5KV
1,270
10
960
750x1000
6112623
VHI 7/22-3T-G-P 70W 240V HM 4,5KV
1,270
10
960
750x1000
6112650
VSI 25/22-3T-E 250W220V VSAPyHM
3,412
5
350
750x1000
6112653
VSI 25/22-3T-E-P
3,465
5
350
750x1000
6112660
VSI 40/22-3T-E 400W220V VSAP
4,700
5
245
750x1000
240
800x1200
6112661
VSI 40/23-3T-E 400W 220V 50Hz Dt=70
4,775
5
245
750x1000
240
800x1200
240
800x1200
240
800x1200
384
800x1200
600W220V VSAP C/TE
250W 220V 50Hz
6112666
VSI 40/22-3T-E-P 400W220V50Hz C/TER
4,775
5
245
750x1000
6112700
VSI 7/22-3T-E
1,252
10
960
750x1000
6112704
VSI 7/22-3T-E-P 70W220V50Hz C/TER
1,270
10
960
750x1000
6112744
VHI 200/38-40-7 2000W 380-400V11,3A
16,700
1
50
750x1000
6112748
VHI 200/23-4
16,095
1
50
750x1000
6112751
VHI 200/38-40-3 2000W 380-400V 8,8A
14,400
1
70
750x1000
6112752
VHI 200/38-40-4 2000W 380-400V10,3A
14,485
1
70
750x1000
6113520
VSI 15/3T-E6-SC-P 150W 220V VSyHM
2,060
10
600
750x1000
6113521
VSI 15/3TE-6-SC 150W 220V60Hz VSyHM
2,060
10
600
750x1000
6113522
VSI 15/3T-EI6-SC-P 150W 220V 60Hz
1,985
10
600
750x1000
6113590
VSI 15/22-3T-E6 150W 220V 60Hz
2,095
5
440
750x1000
6113601
VSI 25/22-3T-E6 220V60Hz VSAPyHM
3,380
5
350
750x1000
70W220V VSAPyHM
2000W 230V
HM
6113610
VSI 40/22-3T-E6 400W 220V 60Hz
4,644
5
245
750x1000
6113675
VHI 7/22-3T-E6 70W220V60Hz
1,235
10
960
750x1000
6113691
VSI 25/3T-E6-SC 250W 220V 60Hz.VSHM
3,010
8
352
750x1000
6113860
VSI 10/22-2
1,700
10
700
750x1000
6113873
VSI 5/22-3T-E6 50W 220V 60Hz
1,270
10
960
750x1000
6113888
VSI 100/3T-E6
9,420
2
100
750x1000
6113920
VSI 7/22-3T-E6 70W 220V 60Hz
1,228
10
960
750x1000
6113979
VSI 60/3T-E6 600W220V60Hz
6113980
VHI 3/22-3 35W 220V 60Hz
6114500
VSI 7/23-2P-RME-SM 70W 230V VSAP
1,793
7
343
750x1000
6114501
VSI 7/23-2P-RASE-SM 70W 230V VSAP
1,910
7
343
750x1000
6114502
VSI 7/23-2P-RSE-CA 70W 230V 50Hz
1,797
7
343
750x1000
6114503
VSI 7/23-2P-RASE-CA 70W 230V 50Hz
1,837
7
343
750x1000
6114561
VSI 25/23-2P-CA-400 250W230V VSAP
3,635
5
250
750x1000
6114581
VSI 10/23-2P-CA-400 100W230V VSAP
1,960
5
250
750x1000
6114595
VSI 15/23-2P-RASE-SMI 150W230V VSAP
2,660
5
245
750x1000
6114597
VSI 15/23-2P-RASE-SMI-P 150W230V
2,660
5
245
750x1000
6114619
VSI 7/23-2P-CA-400-SM 70W230V VSAP
1,910
5
250
750x1000
6114622
VSI 7/23-2P-CA-400
2,004
5
250
750x1000
6114653
VSI 5/23-2P-RASE-CA 50W 230V 50Hz
1,390
7
343
750x1000
6114654
VSI 5/23-2P-RASE-SM 50W 230V VSAP
1,390
7
343
750x1000
6114655
VSI 5/23-2P-RASE-SMI 50W 230V VSAP
1,390
7
343
750x1000
6114664
VSI 10/23-2P-RASE-SMI-P 100W 230V
1,818
7
343
750x1000
6114665
VSI 10/23-2P-RASE-SMI 100W230V VSAP
1,880
7
343
750x1000
6114670
VSI 10/23-2P-RASE-SM 100W 230V VSAP
1,846
7
343
750x1000
6114671
VSI 10/23-2P-RASE-CA 100W 230V 50Hz
1,880
7
343
750x1000
6114680
VSI 15/23-2P-RASE-SM 150W 230V VSAP
2,283
5
245
750x1000
6114681
VSI 15/23-2P-RASE-CA 150W 230V 50Hz
2,286
5
245
750x1000
6114692
VSI 40/23-2P-CA-400 400W230V VSAP
4,920
5
175
750x1000
6114699
VSI 40/23-2P-CA-400-SM 400W230VVSAP
4,920
5
175
750x1000
100W220V60Hz.VSyHM.
1.000W 220V 60Hz
VSAP
70W230V VSAP
6,200
3
180
750x1000
1,230
10
960
750x1000
6114700
VSI 25/23-2P-RASE-SM 250W 230V VSAP
3,605
5
245
750x1000
6114701
VSI 25/23-2P-RASE-CA 250W 230V 50Hz
3,725
5
245
750x1000
6114710
VSI 40/23-2P-RASE-SM 400W 230V VSAP
5,000
4
168
750x1000
6114711
VSI 40/23-2P-RASE-CA 400W 230V 50Hz
5,022
4
168
750x1000
6114725
VSI 7/23-2P-RASE-SMI 70W230V VSAP
1,837
7
343
750x1000
6114726
VSI 7/23-2P-RASE-SMI-P 70W 230V
1,837
7
343
750x1000
6114736
VSI 40/23-2P-RASE-SMI 400W230V VSAP
5,000
4
168
750x1000
6114738
VSI 40/23-2P-RASE-SMI-P 400W230V
5,000
4
168
750x1000
6114902
VSI 10/23-2P-CA-400-SM 100W230VVSAP
1,910
5
250
750x1000
6114912
VSI 15/23-2P-CA-400-SM 150W230VVSAP
2,740
5
250
750x1000
6114923
VSI 25/23-2P-CA-400-SM 250W230VVSAP
3,635
5
250
750x1000
282
www.elt.es
Packaging, unit net weight and pallet conditioning of ELT products
(PEDODMHSHVRXQLWDULRQHWR\DFRQGLFLRQDPLHQWRSRUSDOHWGH
productos ELT
Model
Ref. No.
Modelo
0GVWPKV
YGKIJV
7PKVURGT
DQZ
7PKVURGT
pallet
Pallet
FKOGPUKQP
7PKVURGT
pallet
Pallet
FKOGPUKQP
Peso neto
unitario
Unidades
por caja
Unidades
por palet
Dimensiones
del palet
Unidades
por palet
Dimensiones
del palet
6114927
VSI 25/23-2P-RASE-SMI 250W230V VSAP
3,720
5
245
750x1000
6114929
VSI 25/23-2P-RASE-SMI-P 250W230V
3,720
5
245
750x1000
6114982
VSI 15/23-2P-CA-400 150W230V VSAP
2,390
5
250
750x1000
6210153
VHE 7/23-C2-AI-P 2Mang.
1,635
8
360
750x1000
6210160
VSE 7/23-C2-AD-AF 70W230V VSAP
1,783
8
360
750x1000
6210292
VHE 200/38-40-5-AF-2000 2KW-380IP65
19,000
1
32
800x1000
6210300
VHE 200/38-40-4-AF S/ARRANCAD. IP65
17,000
1
32
800x1000
6210302
VHE 200/38-40-005-AF 2000W380V IP65
17,000
1
32
800x1000
6210303
VHE 200/38-40-3 AF S/ARRANCAD. IP65
16,750
1
32
800x1000
6210304
VHE 200/38-40-4-AF-2000 2KW-380IP65
17,000
1
32
800x1000
6210305
VHE 200/38-40-5 AF S/ARRANCAD. IP65
19,000
1
32
800x1000
6210306
VHE 200/23-002-AF 2000W 230V IP65
19,000
1
32
800x1000
6210310
VSE 7/23-C2-AI-AF 70W230V VSAPyHM
1,796
8
360
750x1000
6210321
VHE 100/23-3-1000-AF 1000W9,5A IP65
12,820
1
32
800x1000
6210322
VSE 100/23-1000-AF 1000W 230V IP65
12,820
1
32
800x1000
6210323
VSE 100/23-100-AF 1000W 10,3A IP65
12,820
1
32
800x1000
6210327
VHE 100/23-002-AF 1000W HPI
12,820
1
32
800x1000
6210580
VSE 15/23-C2-AI-AF 150W230V VSAPyHM
2,760
4
100
750x1000
6210590
VSE 25/23-C2-AI-AF 250W230V VSAPyHM
4,100
4
100
750x1000
6210591
VSE 25/23-C2-AI-P
250W 230V 50H
4,100
4
100
750x1000
6210600
VSE 40/23-C2-AI-AF 400W230V VSAP
5,478
4
100
750x1000
6210601
VSE 40/23-C2-AI-P
5,500
4
100
750x1000
6210610
VSE 10/23-C2-AI-AF 100W230V VSAPyHM
2,110
8
360
750x1000
6210612
VSE 10/23-C2-AI-P
2,110
8
360
750x1000
6210620
VHE 25/23-C2-AI
3,110
4
100
750x1000
6210640
VSE 10/23-C2-AD-AF 100W230V VSAP
2,086
8
360
750x1000
6210650
VSE 15/23-C2-AD-AF 150W230V VSAP
2,790
4
100
750x1000
6210660
VSE 25/23-C2-AD-AF 250W230V VSAPyHM
4,073
4
100
750x1000
6210666
VSE 25/23-C2-AI-P 250W.230V.2 Mang.
4,230
4
100
750x1000
6210680
VHE 40/23-C2-AI-AF 400W230V HM
4,132
4
100
750x1000
6210743
VHE 3/23-C2-AI-AF 35W230V HM
1,635
8
360
750x1000
6210749
VHE 3/23-C2-ADP-P 2Mang. 35W 230V
1,640
8
360
750x1000
6210751
VSE 60/23-100-AF 600W
9,500
1
180
750x1000
6210753
VSE 60/23-1000-AF 600W 230V IP65
9,500
1
32
800x1000
6210811
VSE 15/23-C2-AI-P 2Mang.
3,110
4
100
750x1000
6211510
VSI 7/23-C2-AI 70W 230V VSAPyHM
1,598
8
360
750x1000
6211520
VSI 7/23-C2S-AI 70W 230V VSAPyHM
1,635
8
360
750x1000
6211529
VSI 7/23-C2-AI 70W230V CLEMA
1,600
8
360
750x1000
6211536
VHI 7/23-C2-SC-P 70W230V
1,620
8
360
750x1000
6212130
VSI 7/23-3 AF-150 HALOGENUROS
1,535
8
400
750x1000
6212140
VSI 10/23-2-AF-150 HALOGENUROS
1,930
6
300
750x1000
6212150
VSI 15/23-3 AF-150 HALOGENUROS
2,410
5
250
750x1000
6212160
VSI 25/23-3-AF-400 250W 230V HALOG
3,675
5
250
750x1000
6212180
VMI 40/23-2 AF-400 400W(3,5A) HALOG
3,858
5
250
750x1000
6212210
VSI 10/23-2 AF-100-1 SODIO
1,835
6
300
750x1000
6212230
VSI 25/23-3 AF-100-1 SODIO
3,648
5
250
750x1000
6212251
VSI 7/23-3 AF 70W 230V s/arrancad
1,480
8
400
750x1000
6212260
VSI 15/23-C2-AI 150W 230V VSAPyHM
2,496
4
100
750x1000
6212267
VSI 15/23-C2-SC-P 150W230V VS CLEMA
2,345
8
360
750x1000
6212270
VSI 25/23-C2-AI 250W 230V VSAPyHM
3,947
4
100
750x1000
IP65
400W 230V 50Hz
100W 230V 50Hz
250W 230V
IP65
CLEMA
6212280
VSI 40/23-C2-AI 400W 230V VSAP
5,500
4
100
750x1000
6212290
VSI 15/23-C2S-AI 150W.230V. VSAPyHM
3,110
4
100
750x1000
6212300
VSI 25/23-C2S-AI 250W230V VSAPyHM
4,230
4
100
750x1000
6212310
VSI 40/23-C2S-AI 400W 230V VSAP
5,500
2
50
750x1000
6212320
VHI 25/23-C2-AI 250W 230V
3,110
4
100
750x1000
6212330
VHI 25/23-C2S-AI 250W(2,15A)230VHM
4,200
4
100
750x1000
6212340
VHI 40/23-C2-AI 400W 230V
4,235
4
100
750x1000
6212350
VHI 40/23-C2S-AI 400W 230V
5,500
4
100
750x1000
6212491
VSI 40/23-2-AF-100-1 400W230V SODIO
5,070
5
175
750x1000
6212520
VSI 10/23-C2-AI 100W 230V VSAPyHM
2,110
8
360
750x1000
6212530
VSI 10/23-C2S-AI 100W 230V VSAPyHM
2,110
8
360
750x1000
6212610
VSI 7/23-3 AF-100-1 SODIO
1,535
8
400
750x1000
6212620
VSI 15/23-3 AF-100-1 SODIO
2,275
5
250
750x1000
6212651
VHI 3/23-C2-AI 35W 230V
1,635
8
360
750x1000
www.elt.es
HM
HM
HM
283
Packaging, unit net weight and pallet conditioning of ELT products
(PEDODMHSHVRXQLWDULRQHWR\DFRQGLFLRQDPLHQWRSRUSDOHWGH
productos ELT
Model
Ref. No.
Modelo
0GVWPKV
YGKIJV
7PKVURGT
DQZ
7PKVURGT
pallet
Pallet
FKOGPUKQP
7PKVURGT
pallet
Pallet
FKOGPUKQP
Peso neto
unitario
Unidades
por caja
Unidades
por palet
Dimensiones
del palet
Unidades
por palet
Dimensiones
del palet
6212686
VSI 5/23-ARCE-100-DP 50W 230V SODI
1,440
7
343
750x1000
6212704
VSI 7/23-ARCE-100 70W 230V SODIO
1,405
7
343
750x1000
6212705
VSI 7/23-ARCE-150 70W 230V HALOG
1,450
7
343
750x1000
6212706
VSI 7/23-ARCE-150-P 70W 230V C/TE
1,401
7
343
750x1000
6212713
VSI 10/23-ARCE-100 100W 230V SODIO
1,811
7
343
750x1000
6212714
VSI 10/23-ARCE-150 100W 230V HALOG
1,809
7
343
750x1000
6212715
VSI 10/23-ARCE-150-P 100W 230V C/TE
1,835
7
343
750x1000
6212730
VSI 15/23-ARCE-100 150W 230V SODIO
2,237
5
210
750x1000
6212731
VSI 15/23-ARCE-150 150W 230V HALOG
2,402
5
210
750x1000
6212732
VSI 15/23-ARCE-150-P 150W 230V C/TE
2,409
5
210
750x1000
6212740
VHI 3/23-ARCE-150 35W 230V HALOG
1,432
7
343
750x1000
6212743
VHI 3/23-ARCE-100-DP-P 35W 230V
1,434
7
343
750x1000
6212744
VHI 3/23-ARCE-100-DP
1,434
7
343
750x1000
6212777
VHI 25/23-SC-ARCE-DP 250W2,15A VH
2,210
5
350
750x1000
6212778
VHI 25/23-SC-ARCE-002 250W-2,1A230V
2,230
5
350
750x1000
6212780
VSI 25/23-ARCE-100 250W 230V SODIO
3,735
5
210
750x1000
6212781
VSI 25/23-ARCE-400 250W 230V HALOG
3,725
5
210
750x1000
6212782
VHI 25/23-ARCE-400 250W(2,1A)
2,700
5
210
750x1000
6212783
VHI 25/23-ARCE-002-P 250W(2,1A)C/TE
2,737
5
210
750x1000
6212784
VSI 25/23-ARCE-400-P 250W 230V C/TE
3,700
5
210
750x1000
6212787
VHI 25/23-ARCE-002 250W(2,1A)
2,700
5
210
750x1000
6212790
VSI 40/23-ARCE-100 400W 230V SODIO
5,000
4
120
750x1000
6212791
VSI 40/23-ARCE-400 400W 230V HALOG
5,000
4
120
750x1000
6212792
VHI 40/23-ARCE-400 400W 230V HALOG
3,777
5
210
750x1000
6212793
VHI 40/23-ARCE-002 400W 230V 50Hz
3,700
5
210
750x1000
6212796
VHI 40/23-ARCE-400-P 400W 230V C/TE
3,779
5
210
750x1000
6212802
VSI 60/3T-D-ARCE-100 600W230V SODIO
7,000
2
128
800x1000
6212830
VHI 40/23-ARCE-002-P 400W 230V C/TE
3,700
5
210
750x1000
6212840
VSI 15/23-SC-ARCE-DP 150W230V VSyHM
2,210
5
350
750x1000
6218200
VSE 7/23-2P-C2-AF s/Arr 70W 230V
2,110
8
300
750x1000
6218210
VSE 10/23-2P-C2-AF 100W 230V 50Hz
3,110
4
100
750x1000
6218211
VSE 10/23-2P-C2-AF-SM 100W 230V
3,110
4
100
750x1000
6218220
VSE 15/23-2P-C2-AF 150W 230V 50Hz
3,110
4
100
750x1000
6218221
VSE 15/23-2P-C2-AF-SM 150W 230V
2,848
4
100
750x1000
6218230
VSE 25/23-2P-C2-AF 250W 230V 50Hz
4,230
4
100
750x1000
6218231
VSE 25/23-2P-C2-AF-SM 250W 230V
4,230
4
100
750x1000
6218240
VSE 40/23-2P-C2-AF 400W 230V 50Hz
5,650
4
100
750x1000
6218241
VSE 40/23-2P-C2-AF-SM 400W 230V
5,650
4
100
750x1000
6218250
VSE 7/23-2P-C2-AF-SM 70W 230V
3,110
4
100
750x1000
6218251
VSE 7/23-2P-C2-AF
2,800
4
100
750x1000
8224591
TR 105/23-01-B 105VA 230-12V
1,949
10
700
750x1000
8224700
TR 5/23-01-SC 50VA 230-12V
0,773
20
1400
750x1000
8224725
TR 5/22-01-SC 50VA 220-12V 50/60Hz
0,775
20
1400
750x1000
9313022
BE 1150-MH 150W H.Metal.Electron
0,526
12
756
800x1200
9313050
BE 120-MH-5 s/t
20W 220-240V
0,130
20
1200
800x1200
9313051
BE 135-MH-5 s/t
35W 220-240V
0,220
16
960
800x1200
9313052
BE 150-MH-5 s/t
50W 220-240V
0,220
16
960
800x1200
9313053
BE 170-MH-5 s/t
70W 220-240V
0,220
16
960
800x1200
9313054
BE 1100-MH-5 s/t
100W 220-240V
0,306
12
720
800x1200
9313055
BE 1150-MH-5 s/t
150W 220-240V
0,540
6
450
800x1200
9313060
BE 120-MH-5 c/t
20W 220-240V
0,145
10
1200
800x1200
9313061
BE 135-MH-5 c/t
35W 220-240V
0,260
6
480
800x1200
9313062
BE 150-MH-5 c/t
50W 220-240V
0,260
6
480
800x1200
9313063
BE 170-MH-5 c/t
70W 220-240V
0,260
6
480
800x1200
9313064
BE 1100-MH-5 c/t
100W 220-240V
0,350
7
525
800x1200
9313065
BE 1150-MH-5 c/t
150W 220-240V
0,582
10
480
800x1200
9313090
BE 120-MH-2
20W HM / TAPA
0,271
14
1120
750x1000
9313091
BE 120-MH-2
20W HM s/Tapa
0,250
18
1440
750x1000
35W 230V
70W 230V 50Hz
9313100
BE 135-MH-2
35W HM / TAPA
0,271
14
1120
750x1000
9313101
BE 135-MH-2
35W HM s/Tapa
0,250
18
1440
750x1000
9313110
BE 170-MH-2
70W HM / TAPA
0,275
14
1120
750x1000
9313111
BE 170-MH-2
70W HM s/Tapa
0,262
18
1440
750x1000
9313120
BE 1150-MH-2
150W HM / TAPA
9313121
BE 1150-MH-2 s/tapa 150W 220-240V
0,403
10
800
750x1000
0,386
13
1040
750x1000
284
www.elt.es
Packaging, unit net weight and pallet conditioning of ELT products
(PEDODMHSHVRXQLWDULRQHWR\DFRQGLFLRQDPLHQWRSRUSDOHWGH
productos ELT
Model
Ref. No.
Modelo
0GVWPKV
YGKIJV
7PKVURGT
DQZ
7PKVURGT
pallet
Pallet
FKOGPUKQP
7PKVURGT
pallet
Pallet
FKOGPUKQP
Peso neto
unitario
Unidades
por caja
Unidades
por palet
Dimensiones
del palet
Unidades
por palet
Dimensiones
del palet
9410020
CE1 4/01 18-20-36-40W. 12V
0,495
10
-
-
9410030
CE1 4/02 18-20-36-40W. 26V.
0,495
10
-
-
9410040
CE1 4/04 18-20-36-40W. 48V.
0,495
10
-
-
9410050
CE1 4/07 18-20-36-40W. 72V.
0,495
10
-
-
9410060
CE1 4/11 18-20-36-40W. 110V.
0,495
10
-
-
9513040
FES 6-80 / 4SC / 60
0,420
25
500
750x1000
9513041
4,8 V 1,8 Ah NiCd
0,040
1
-
-
9513050
FES 6-80 / 4D / 180
0,730
25
500
750x1000
9513051
4,8 V 4,5 Ah NiCd
0,011
1
-
-
9610004
BE 114-35-T5 1x14-21-28-35W 220-240
0,256
16
1456
750x1000
9610005
BE 124-T5
1x24W
220-240V
0,251
16
1456
750x1000
9610006
BE 139-T5
1x39W
220-240V
0,287
16
1456
750x1000
9610007
BE 149-T5
1x49W
220-240V
0,278
16
1456
750x1000
9610008
BE 154-T5
1x54W
220-240V
0,287
16
1456
750x1000
9610012
BE 180-T5
1x80W
220-240V
0,287
16
1456
750x1000
9610013
BE 158-2 1x54-55-58W
0,229
24
1512
750x1000
9610030
BE 114-35-T5-S 1x14-21-28-35W T5
0,176
28
1960
750x1000
9610031
BE 124-T5-S 1x24W 220-240V T5
0,176
28
1960
750x1000
9610032
BE 139-T5-S 1x39W 220-240V T5
0,177
28
1960
750x1000
9610033
BE 149-T5-S 1x49W 220-240V T5
0,200
28
1960
750x1000
9610034
BE 154-T5-S 1x54W 220-240V T5
0,191
28
1960
750x1000
9610035
BE 180-T5-S 1x80W 220-240V T5
0,197
28
1960
750x1000
9610036
BE 114-35-T5-S-UN
0,178
28
1960
750x1000
9610037
BE 124-T5-S-UN
110-260V 50-60Hz
0,200
28
1960
750x1000
9610038
BE 139-T5-S-UN
110-260V 50-60Hz
0,200
28
1960
750x1000
9610111
BE 136-2 1x18-24-36-39W 220-240V
0,224
24
1512
750x1000
9610132
BE 180-T5-2
0,225
24
1512
750x1000
9610141
BE 118-4-UN 1x18W 110-240V 50-60Hz
0,212
24
1512
750x1000
9610150
BE 136-3
1X18-36W
0,212
24
1512
750x1000
9610160
BE 158-3
1X58W
0,218
24
1512
750x1000
9610161
BE 158-4-UN 1X58w 110-240V 50-60Hz
0,231
24
1512
750x1000
9610180
BE 136-4-UN 1x36w 110-240V 50-60Hz
0,211
24
1512
750x1000
9610250
BE 158-UN-277V
0,263
24
1512
750x1000
9614030
DBE-114-35 1x14-21-28-35W T5HE
0,304
24
1344
750x1000
9614040
DBE-118-40 1x18-36-40T8/TCL 24-39T5
0,297
24
1344
750x1000
9614050
DBE-154-58 1x58WT8 55WTCL 54WT5HO
0,307
24
1344
750x1000
9614061
DBE 135/49/80-DALI
0,282
32
1792
750x1000
2016
800x1200
9614062
DBE 114/24-DALI 1x14/24W 220-240V
0,273
32
1792
750x1000
2016
800x1200
9614063
DBE 118-DALI
1x18W 220-240V
0,305
32
1792
750x1000
2016
800x1200
9614064
DBE 136-DALI
1x36W 220-240V
0,271
32
1792
750x1000
2016
800x1200
220-240V
110-260V
1x80WT5HO 220-240V
220-240V
220-240V
1x35/49/80W
9614065
DBE 121/39-DALI 1x21/39W 220-240V
0,305
32
1792
750x1000
2016
800x1200
9614066
DBE 128/54-DALI 1x28/54W 220-240V
0,268
32
1792
750x1000
2016
800x1200
9614067
DBE 158-DALI
9614072
DBE 118/57-TC-DALI
9616010
BE 118-EN
9616011
BE 118-EN-2
9616012
BE 118-EN-3 1x18W 230V C/CONEC.
0,785
9616020
BE 136-EN
0,785
9616021
BE 136-EN-2
0,840
12
9616022
BE 136-EN-3 1x36W 230V C/CONEC.
0,785
12
360
800x1000
9616030
BE 158-EN
0,815
12
360
800x1000
9616031
BE 158-EN-2
1x58W C/PORTAL.IP64
0,860
12
360
800x1000
9616032
BE 158-EN-3 1x58W 230V C/CONEC.
0,798
12
360
800x1000
9616102
BE 1150-EN-MH-SMI (-2+5h)
1x150W
0,900
8
560
750x1000
9616105
BE 1150-EN-MH
1x150W 220-240V
0,900
8
560
750x1000
9616106
BE 1150-EN-HPS-SMI2
0,900
8
560
750x1000
9616107
DBE 1150-EN-MH
0,900
8
560
750x1000
9616109
BE 1150-EN-MH-SMI2 1x150W 220-240V
0,900
8
560
750x1000
9616112
BE 145-EN-MH-SMI (-2+5h)
1x45W
0,900
8
560
750x1000
9616114
DBE 145-EN-MH
1x45W 220-240V
0,900
8
560
750x1000
9616122
BE 150-EN-MH-SMI (-2+5h)
1x50W
0,900
8
560
750x1000
9616123
BE 150-EN-MH
1x50W 220-240V
0,900
8
560
750x1000
9616124
DBE 150-EN-MH
0,900
8
560
750x1000
9616125
BE 150-EN-HPS-SMI2 1x50W 220-240V
0,900
8
560
750x1000
www.elt.es
1x58W 220-240V
1x18/57W
1x18W 230V Electr.Enc
1X18W C/PORTAL.IP64
1x36W 230V Electr.Enc
1x36W C/PORTAL.IP64
1x58W 230V Electr.Enc
1x150W
1x150W 220-240V
1x50W 220-240V
0,273
32
1792
750x1000
2016
800x1200
0,227
21
1176
750x1000
1323
800x1200
0,785
12
360
800x1000
0,840
12
360
800x1000
12
360
800x1000
12
360
800x1000
360
800x1000
285
Packaging, unit net weight and pallet conditioning of ELT products
Embalaje, peso unitario neto y acondicionamiento por palet de
productos ELT
Model
Ref. No.
Modelo
1x50W 220-240V
Net unit
weight
Units per
box
Units per
pallet
Pallet
dimension
Units per
pallet
Pallet
dimension
Peso neto
unitario
Unidades
por caja
Unidades
por palet
Dimensiones
del palet
Unidades
por palet
Dimensiones
del palet
9616126
BE 150-EN-MH-SMI2
9616132
BE 160-EN-MH-SMI (-2+5h)
0,900
8
560
750x1000
1x60W
0,900
8
560
9616134
DBE 160-EN-MH
750x1000
1x60W 220-240V
0,900
8
560
9616142
BE 170-EN-MH-SMI (-2+5h)
750x1000
0,900
8
560
750x1000
9616145
BE 170-EN-MH
9616146
DBE 170-EN-MH
9616147
9616148
9616152
BE 190-EN-MH-SMI (-2+5h)
9616154
DBE 190-EN-MH
9616162
BE 1100-EN-MH-SMI (-2+5h)
9616165
BE 1100-EN-MH
9616166
BE 1100-EN-HPS-SMI2
9616167
DBE 1100-EN-MH
0,900
8
560
750x1000
9616169
BE 1100-EN-MH-SMI2 1x100W 220-240V
0,900
8
560
750x1000
9616172
BE 1140-EN-MH-SMI (-2+5h)
1x140W
0,900
8
560
750x1000
9616174
DBE 1140-EN-MH
1x140W 220-240V
0,900
8
560
750x1000
9620005
BE 214-35-T5 2x14-21-28-35W 220-240
0,304
16
1456
750x1000
9620006
BE 224-T5
2x24W
220-240V
0,287
16
1456
750x1000
9620007
BE 239-T5
2x39W
220-240V
0,287
16
1456
750x1000
9620008
BE 249-T5
2x49W
220-240V
0,312
16
1456
750x1000
9620009
BE 254-T5
2x54W
220-240V
0,320
16
1456
750x1000
9620013
BE 258-2 2x54-55-58W
0,239
24
1512
750x1000
9620014
BE 236-2 2x18-24-36-39W 220-240V
0,228
24
1512
750x1000
9620016
BE 280-T5
2x80W
0,396
18
1008
750x1000
9620022
BE 236-IS
2x36W 220-240V 50-60Hz
0,207
24
1512
750x1000
9620032
BE 232-4-UN 2x32W 110-240V 50-60Hz
0,235
24
1512
750x1000
9620060
BE 275-UV 2x41-75W 220-240V 50-60Hz
0,375
18
1008
750x1000
9620061
BE 275-UV-LED 2x41-75W
0,400
18
1008
750x1000
9620070
BE 214-35-T5-S 2x14-21-28-35W T5
0,195
28
1960
750x1000
9620071
BE 224-T5-S 2x24W 220-240V T5
0,192
28
1960
750x1000
9620072
BE 239-T5-S 2x39W 220-240V T5
0,192
28
1960
750x1000
9620073
BE 214-21-T5-S-UN 2X14-21W 110-260V
0,195
28
1960
750x1000
9620109
BE 214-28-UN-277V2x14-21-28W110-277
0,253
24
1512
750x1000
9620110
BE 236-UN-277V
0,263
24
1512
750x1000
9621011
BE 218-4-UN 1y2x15-18W 110-240V50-6
0,213
24
1512
750x1000
9621020
BE 236-3
9621021
BE 236-4-UN 2x36w 110-240V 50-60Hz
9621030
BE 258-3
0,235
24
1512
750x1000
9621101
BE 213-TC-3 s/tapa 2x13W 220-240V
0,129
30
1680
750x1000
9621102
BE 218-TC-3 s/tapa 2x18W 220-240V
0,125
30
1680
750x1000
9621103
BE 226-TC-3 s/tapa 2x26W 220-240V
0,126
30
1680
750x1000
9621104
BE 242-TC-3 s/tapa 2x42W 220-240V
0,110
30
1680
750x1000
9621130
BE 226-TC-3-C2
2x26W 220-240V
0,164
20
882
750x1000
9621131
BE 218-TC-3-C2
2x18W 220-240V
0,164
20
882
750x1000
9621132
BE 213-TC-3-C2
2x13W 220-240V
0,164
20
882
750x1000
9621133
BE 242-TC-3-C2
2X42W 220-240V
0,164
20
882
750x1000
9621160
BE 213-TC-4-UN s/tap 2x13W 110-240V
0,125
30
1680
750x1000
9621161
BE 218-TC-4-UN s/tap 2x18W 110-240V
0,124
30
1680
750x1000
9621162
BE 226-TC-4-UN s/tap 2x26W 110-240V
0,135
30
1680
750x1000
9621170
BE 213-TC-4-UN-C2
2x13W 110-240V
0,164
20
882
750x1000
9621171
BE 218-TC-4-UN-C2
2x18W 110-240V
0,164
20
882
750x1000
9621172
BE 226-TC-4-UN-C2
2x26W 110-240V
0,164
20
882
750x1000
9621180
BE 213-TC-5 s/tapa 2x13W 220-240V
0,125
30
1680
750x1000
9621181
BE 218-TC-5 s/tapa 2x18W 220-240V
0,130
30
1680
750x1000
9621182
BE 226-TC-5 s/tapa 2x26W 220-240V
0,130
30
1680
750x1000
9621183
BE 242-TC-5 s/tapa 2x42W 220-240V
0,143
30
1680
750x1000
9621190
BE 213-TC-5-C2
2x13W 220-240V
0,160
20
882
750x1000
9621191
BE 218-TC-5-C2
2x18W 220-240V
0,164
20
882
750x1000
9621192
BE 226-TC-5-C2
2x26W 220-240V
0,167
20
882
750x1000
9621193
BE 242-TC-5-C2
2x42W 220-240V
0,180
20
882
750x1000
9621200
BE 214-28-T5-2 2x14-28 1x14-35W
0,228
24
1512
750x1000
9624030
DBE-214-35 2x14-21-28-35W T5HE
0,350
24
1344
750x1000
9624040
DBE-218-40 2x18-36-40T8/TCL 24-39T5
0,350
24
1344
750x1000
1x70W
1x70W 220-240V
0,900
8
560
750x1000
0,900
8
560
750x1000
BE 170-EN-HPS-SMI2 1x70W 220-240V
0,900
8
560
750x1000
BE 170-EN-MH-SMI2
0,900
8
560
750x1000
1x90W
0,900
8
560
750x1000
1x90W 220-240V
0,900
8
560
750x1000
0,900
8
560
750x1000
1x70W 220-240V
1x70W 220-240V
1x100W
1x100W 220-240V
1x100W 220-240V
220-240V
220-240V
2X18-36W
2x58W
220-240V
220-240V
0,900
8
560
750x1000
0,900
8
560
750x1000
0,219
24
1512
750x1000
0,229
24
1512
750x1000
286
www.elt.es
Packaging, unit net weight and pallet conditioning of ELT products
Embalaje, peso unitario neto y acondicionamiento por palet de
productos ELT
Model
Ref. No.
Modelo
Net unit
weight
Units per
box
Units per
pallet
Pallet
dimension
Units per
pallet
Pallet
dimension
Peso neto
unitario
Unidades
por caja
Unidades
por palet
Dimensiones
del palet
Unidades
por palet
Dimensiones
del palet
9624050
DBE-254-58 2x58WT8 55WTCL 54WT5HO
0,335
24
1344
750x1000
9624060
DBE 235/49-DALI 2x35/49W 220-240V
0,370
20
1260
800x1000
9624061
DBE 235/49/80-DALI
0,376
20
1260
800x1000
9624062
DBE 214/24-DALI 2x14/24W 220-240V
0,370
20
1260
800x1000
9624063
DBE 218-DALI
2x18W 220-240V
0,370
20
1260
800x1000
9624064
DBE 236-DALI
2x36W 220-240V
0,370
20
1260
800x1000
9624065
DBE 221/39-DALI 2x21/39W 220-240V
0,370
20
1260
800x1000
9624066
DBE 228/54-DALI 2x28/54W 220-240V
0,370
20
1260
800x1000
9624067
DBE 258-DALI
0,370
20
1260
800x1000
9624072
DBE 218/42-TC-DALI
0,247
21
1323
800x1200
9626010
BE 218-EN
0,995
8
240
800x1000
9626011
BE 218-EN-2
2x18W C/PORTAL.IP64
0,980
8
240
800x1000
9626013
BE 218-EN-3 2x18W 230V C/CONEC.
0,968
8
240
800x1000
9626020
BE 236-EN
0,995
8
240
800x1000
9626021
BE 236-EN-2
2x36W C/PORTAL.IP64
1,025
8
240
800x1000
9626022
BE 236-EN-3 2x36W 230V C/CONEC.
1,022
8
240
800x1000
9626030
BE 258-EN
9626031
BE 258-EN-2
9626032
BE 258-EN-3 2x58W 230V C/CONEC.
1,090
8
240
800x1000
9630008
BE 324-T5-2 3x24W 220-240V 50-6OHz
0,213
24
1344
750x1000
1512
800x1200
9630010
BE 336-2 3x36W(T8-TCL)-24W(T5)
0,345
18
1344
750x1000
1512
800x1200
800x1200
2x35/49/80W
2x58W 220-240V
2x18/42W
2x18W 230V Electr.Enc
2x36W 230V Electr.Enc
2x58W 230V Electr.Enc
2x58W C/PORTAL.IP64
1,078
8
240
800x1000
1,080
8
240
800x1000
9634062
DBE 314/24-DALI 3x14/24W 220-240V
0,420
24
1344
750x1000
1512
9634063
DBE 318-DALI
0,380
24
1344
750x1000
1512
800x1200
9640005
BE 414-T5-2 3-4x14W 220-240V 50-60
0,339
24
1512
750x1000
1680
800x1200
3x18W 220-240V
9640008
BE 436-2 3-4x36W(T8-TCL)-24W(T5)
0,385
18
1008
750x1000
1134
800x1200
9640009
BE 424-T5-2 4x24W 220-240V 50-60Hz
0,348
18
1008
750x1000
1134
800x1200
9640011
BE 418-2 3-4X18W(T8-TCL) 220-240V
0,215
24
1512
750x1000
9640017
BE 418-4-UN 3-4x18W(T8-TCL)100-260V
0,229
24
1512
750x1000
9640021
BE 414-T5-4-UN
3-4x14W 100-260V
0,231
24
1512
750x1000
9640200
BE 418-IS
4x18W 220-240V 50-60Hz
0,217
24
1512
750x1000
9644062
DBE 414/24-DALI 4x14/24W 220-240V
0,420
24
1344
750x1000
1512
800x1200
9644063
DBE 418-DALI
0,374
24
1344
750x1000
1512
800x1200
9810010
TCE 5/23-E 20-50VA 230-240V 50-60H
0,078
25/150
3000
800x1000
9813030
TCE 6/23-E 20-60VA 230-240V 50-60H
0,078
25/150
3000
800x1000
9813040
TCE 7/23-E 20-70VA 230-240V 50-60H
0,083
25/150
3000
800x1000
9813050
TCE 10/23-E 20-105VA 230-240V 50-60
0,097
25/150
3000
800x1000
9900002
CONDENSADOR 2uF +-5% 250V
0,030
180
4800
750x1000
9900004
CONDENSADOR 2,5uF +-5% 250V
0,020
180
4800
750x1000
9900007
CONDENSADOR 4uF +-5% 250V
0,030
180
4800
750x1000
9900008
CONDENSADOR 4,5uF +-5% 250V
0,030
180
4800
750x1000
9900009
CONDENSADOR 5uF +-5% 250V
0,034
180
4800
750x1000
9900010
CONDENSADOR 5,5uF +-5% 250V
0,040
180
4800
750x1000
9900011
CONDENSADOR 6uF +-5% 250V
0,039
140
4800
750x1000
9900012
CONDENSADOR 7uF +-5% 250V
0,050
140
4800
750x1000
9900013
CONDENSADOR 8uF +-5% 250V
0,050
140
4800
750x1000
9900014
CONDENSADOR 9uF +-5% 250V
0,045
140
4800
750x1000
9900015
CONDENSADOR 10uF +-5% 250V
0,060
140
2000
750x1000
9900016
CONDENSADOR 11uF +-5% 250V
0,050
100
2000
750x1000
9900017
CONDENSADOR 12uF +-5% 250V
0,060
100
2000
750x1000
9900018
CONDENSADOR 13uF +-5% 250V
0,054
100
2000
750x1000
9900019
CONDENSADOR 14uF +-5% 250V
0,070
100
2000
750x1000
9900020
CONDENSADOR 16uF +-5% 250V
0,060
100
2700
750x1000
9900021
CONDENSADOR 18uF +-5% 250V
0,080
60
2700
750x1000
9900022
CONDENSADOR 20uF +-5% 250V
0,080
60
2700
750x1000
9900023
CONDENSADOR 22uF +-5% 250V
0,100
50
2700
750x1000
9900024
CONDENSADOR 25uF +-5% 250V
0,075
60
2100
750x1000
9900025
CONDENSADOR 28uF +-5% 250V
0,085
60
2100
750x1000
9900026
CONDENSADOR 30uF +-5% 250V
0,085
60
2100
750x1000
9900027
CONDENSADOR 32uF +-5% 250V
0,097
60
2100
750x1000
9900028
CONDENSADOR 36uF +-5% 250V
0,120
60
2100
750x1000
9900029
CONDENSADOR 40uF +-5% 250V
0,180
32
-
-
9900030
CONDENSADOR 45uF +-5% 250V
0,120
32
-
-
9900031
CONDENSADOR 50uF +-5% 250V
0,145
28
-
-
9900802
CONDENSADOR 4,5uF+-10%250V FIJ.RAPI
0,069
180
4800
750x1000
www.elt.es
4x18W 220-240V
287
Packaging, unit net weight and pallet conditioning of ELT products
Embalaje, peso unitario neto y acondicionamiento por palet de
productos ELT
Model
Ref. No.
Modelo
Net unit
weight
Units per
box
Units per
pallet
Pallet
dimension
Units per
pallet
Pallet
dimension
Peso neto
unitario
Unidades
por caja
Unidades
por palet
Dimensiones
del palet
Unidades
por palet
Dimensiones
del palet
9900803
CONDENSADOR 5uF+-10%250V FIJ.RAPID
0,069
180
4800
750x1000
9900804
CONDENSADOR 5,5uF+-10%250V FIJ.RAPI
0,069
180
4800
750x1000
9900805
CONDENSADOR 7uF+-10%250V FIJ.RAPID
0,069
140
4800
750x1000
9900806
CONDENSADOR 9uF+-10%250V FIJ.RAPID
0,075
140
4800
750x1000
9900807
CONDENSADOR 10uF+-10%250V FIJ.RAPID
0,075
140
4800
750x1000
9900808
CONDENSADOR 14uF+-10%250V FIJ.RAPID
0,095
100
2700
750x1000
9900809
CONDENSADOR 16uF+-10%250V FIJ.RAPID
0,121
100
2700
750x1000
9900810
CONDENSADOR 18uF+-10%250V FIJ.RAPID
0,121
60
2100
750x1000
9900811
CONDENSADOR 20uF+-10%250V FIJ.RAPID
0,121
60
2100
750x1000
9900812
CONDENSADOR 2uF+-10%250V FIJ.RAPID
0,069
180
4800
750x1000
9900813
CONDENSADOR 2,5uF+-10%250V FIJ.RAPI
0,069
180
4800
750x1000
9900814
CONDENSADOR 4uF+-10%250V FIJ.RAPID
0,069
180
4800
750x1000
9900815
CONDENSADOR 6uF+-10%250V FIJ.RAPID
0,069
140
4800
750x1000
9900816
CONDENSADOR 8uF+-10%250V FIJ.RAPID
0,077
140
4800
750x1000
9900817
CONDENSADOR 11uF+-10%250V FIJ.RAPID
0,077
100
2700
750x1000
9900818
CONDENSADOR 12uF+-10%250V FIJ.RAPID
0,098
100
2700
750x1000
9900819
CONDENSADOR 13uF+-10%250V FIJ.RAPID
0,098
100
2700
750x1000
9901250
CONDENSADOR 30uF +-5% 440V
0,256
25
-
-
9901607
CONDENSADOR 3,6uF. +-4% 420V.
0,100
100
2700
750x1000
9901613
CONDENSADOR 5,7uF. +-4% 420V.
0,090
50
-
-
9901627
CONDENSADOR 45uF. +-5% 440V.
0,300
25
-
-
9907103
FAV 15/12-B
15W 12V
0,071
21
2520
800x1000
9907123
FAV 15/24-B
15W 24V
0,071
21
2520
800x1000
9907104
FAV 20/12-B
20W 12V
0,101
17
2040
800x1000
9907105
FAV 30/12-B
30W 12V
0,175
12
1092
750x1000
9907124
FAV 20/24-B
20W 24V
0,101
17
2040
800x1000
9907125
FAV 30/24-B
30W 24V
0,176
12
1092
750x1000
9907107
FAV 50/12-B
50W 12V
0,294
8
960
800x1000
9907108
FAV 75/12-B
75W 12V
0,346
10
560
750x1000
9907127
FAV 50/24-B
50W 24V
0,291
8
960
800x1000
9907128
FAV 75/24-B
75W 24V
0,346
10
560
750x1000
9907148
FAV 75/12-B-EN 75W 12V IP67
0,816
7
41
750x1000
490
800x1200
9907149
FAV 100/12-B-EN
100W 12V IP67
0,895
7
392
750x1000
441
800x1200
9907151
FAV 200/12-B-EN
200W 12V IP67
1,100
10
9907168
FAV 75/24-B-EN 75W 24V IP67
0,824
7
441
750x1200
490
800x1200
9907169
FAV 100/24-B-EN
100W 24V IP67
0,907
7
392
750x1000
441
800x1200
9907171
FAV 200/24-B-EN
200W 24V IP67
1,100
10
9916000
LC 116/350-EN-2 IP67 1x16W 220-240V
0,392
10
800
750x1000
9916001
LC 116/500-EN-2 IP67 1x16W 220-240V
0,392
10
800
750x1000
9916002
LC 116/700-EN-2 IP67 1x16W 220-240V
0,392
10
800
750x1000
9916010
LC 125/350-EN-2 IP67 1x25W 110-240V
0,392
10
800
750x1000
9916011
LC 125/500-EN-2 IP67 1x25W 110-240V
0,392
10
800
750x1000
9916012
LC 125/700-EN-2 IP67 1x25W 220-240V
0,386
10
800
750x1000
9916021
LC 110/350-EN IP67 1x10W 220-240V
0,145
30
3150
750x1000
9916022
LC 110/500-EN IP67 1x10W 220-240V
0,145
30
3150
750x1000
9916023
LC 110/700-EN IP67 1x10W 220-240V
0,145
30
3150
750x1000
9916024
LC 109/1050-EN IP67 1x9W 220-240V
0,145
30
3150
750x1000
9916081
DLC 110/350-EN IP67 1x10W 220-240V
0,145
30
3150
750x1000
9916082
DLC 110/500-EN IP67 1x10W 220-240V
0,145
30
3150
750x1000
9916083
DLC 110/700-EN IP67 1x10W 220-240V
0,145
30
3150
750x1000
9916084
DLC 109/1050-EN IP67 1x9W 220-240V
0,145
30
3150
750x1000
9916101
LC 190/350-XT
1x40-90W 220-240V
0,835
8
560
750x1000
9916102
LC 190/500-XT
1x40-90W 220-240V
0,843
8
560
750x1000
9916103
LC 190/700-XT
1x40-90W 220-240V
0,848
8
560
750x1000
8
560
750x1000
0,898
8
560
750x1000
9916104
LC 190/1050-XT 1x40-90W 220-240V
9916113
LC 1150/700-XT 1x80-150W 220-240V
9918009
LC 125/300-A
1x25W 220-240V
0,100
25/150
3000
800x1000
9918010
LC 116/350-A
1x16W 220-240V
0,097
25/150
3000
800x1000
9918011
LC 116/500-A
1x16W 220-240V
0,097
25/150
3000
800x1000
9918012
LC 116/700-A
1x16W 220-240V
0,097
25/150
3000
800x1000
9918014
LC 125/600-A
1x25W 220-240V
0,097
25/150
3000
800x1000
9918015
LC 125/350-A
1x25W 110-240V
0,099
25/150
3000
800x1000
9918016
LC 125/500-A
1x25W 110-240V
0,097
25/150
3000
800x1000
9918018
LC 125/640-A
1x25W 220-240V
0,097
25/150
3000
800x1000
288
www.elt.es
Packaging, unit net weight and pallet conditioning of ELT products
Embalaje, peso unitario neto y acondicionamiento por palet de
productos ELT
Model
Ref. No.
Modelo
Net unit
weight
Units per
box
Units per
pallet
Pallet
dimension
Units per
pallet
Pallet
dimension
Peso neto
unitario
Unidades
por caja
Unidades
por palet
Dimensiones
del palet
Unidades
por palet
Dimensiones
del palet
9918022
LC 110/500-B
1x10W 220-240V
0,049
30
3150
750x1000
9918023
LC 110/700-B
1x10W 220-240V
0,049
30
3150
750x1000
9918024
LC 109/1050-B
1x9W 220-240V
0,049
30
3150
750x1000
9918026
LC 102/350-B
1x2W 220-240V
0,049
30
3150
750x1000
9918027
LC 103/500-B
1x3W 220-240V
0,049
30
3150
750x1000
9918028
LC 104/700-B
1x4W 220-240V
0,049
30
3150
750x1000
9918029
LC 101/060-B
1x1W 220-240V
0,049
30
3150
750x1000
9918031
DLC 110/350-B
1x10W 220-240V
0,050
30
3150
750x1000
9918032
DLC 110/500-B
1x10W 220-240V
0,050
30
3150
750x1000
9918033
DLC 110/700-B
1x10W 220-240V
0,050
30
3150
750x1000
9918034
DLC 109/1050-B
1x9W 220-240V
0,050
30
3150
750x1000
9918035
DLC 108/200-B
1x8W 220-240V
0,050
30
3150
750x1000
9918036
DLC 111/300-B
1x11W 220-240V
0,050
30
3150
750x1000
9918040
LC 160/700-C
1x35..60W 220-240V
0,240
24
1512
750x1000
9918041
LC 152/1050-C
1x52W 220-240V
0,236
24
1512
750x1000
9918042
LC 142/600-C
1x21..42W 220-240V
0,248
24
1512
750x1000
9918043
LC 142/650-C
1x21..42W 220-240V
0,242
24
1512
750x1000
9918044
LC 142/700-C
1x24..42W 220-240V
0,238
24
1512
750x1000
9918045
LC 152/600-C
1x30..52W 220-240V
0,248
24
1512
750x1000
9918046
LC 156/650-C
1x32..56W 220-240V
9918080
LC 152/600-C-UN 1x21..52W 110-240V
9918081
LC 152/650-C-UN 1x23..52W 110-240V
0,236
24
1512
750x1000
9918082
LC 152/700-C-UN 1x25..52W 110-240V
0,236
24
1512
750x1000
9918102
LC 142/700-D
9918103
LC 150/350-D 1x50W 220-240V
9918105
LC 150/500-D 1x50W 220-240V
0,239
16
1456
750x1000
9918107
LC 150/700-D 1x50W 220-240V
0,230
16
1456
750x1000
9918109
LC 148/1050-D 1x50W 220-240V
0,250
16
1456
750x1000
9918117
LC 190/700-D
0,269
16
1456
750x1000
9918123
LC 150/350-D-UN
1x50W 110-277V
0,250
16
1456
750x1000
9918125
LC 150/500-D-UN
1x50W 110-277V
0,250
16
1456
750x1000
9918127
LC 150/700-D-UN
1x50W 110-277V
0,250
16
1456
750x1000
9918129
LC 148/1050-D-UN
1x48W 110-277V
9918137
DLC 150/700-D-DALI 1x50W 220-240V
9918147
DLC 190/700-D-DALI 1x90W 220-240V
0,250
16
1456
750x1000
9918171
LC 150/350-E 1x21...50W 220-240V
0,123
30
1680
750x1000
9918172
LC 150/500-E 1x21...50W 220-240V
0,123
30
1680
750x1000
9918173
LC 150/700-E 1x21...50W 220-240V
0,123
30
1680
750x1000
9918174
LC 148/1050-E 1x21...50W 220-240V
0,123
30
1680
750x1000
9918175
LC 142/1400-E 1x18...42W 220-240V
0,136
30
1680
750x1000
9918181
LC 150/350-E-C2 1x21...50W 220-240V
0,164
20
1000
750x1000
9918182
LC 150/500-E-C2 1x21...50W 220-240V
0,164
20
1000
750x1000
9918183
LC 150/700-E-C2 1x21...50W 220-240V
0,164
20
1000
750x1000
9918184
LC 148/1050-E-C2 1x21..50W 220-240V
0,164
20
1000
750x1000
9918185
LC 142/1400-E-C2 1x18..42W 220-240V
0,164
20
1000
750x1000
9918187
LC 150/900-E-C2 1x23...50W 220-240V
0,164
20
1000
750x1000
9918200
LTC 5/23-LED 5-50W 12VAC LED LAMP
0,088
25/150
3000
800x1000
9918211
LC 150/350-E-FAN 1x21..50W 220-240V
0,129
30
1680
750x1000
9918212
LC 150/500-E-FAN 1x21..50W 220-240V
0,128
30
1680
750x1000
9918213
LC 150/700-E-FAN 1x21..50W 220-240V
0,127
30
1680
750x1000
9918214
LC 148/1050-E-FAN 1x21..48W 220-240
0,129
30
1680
750x1000
9918215
LC 142/1400-E-FAN 1x21..40W 220-240
0,123
30
1680
750x1000
9918221
LC 150/350-E-C2-FAN
1x21...50W
0,166
20
1000
750x1000
9918222
LC 150/500-E-C2-FAN
1x21...50W
0,165
20
1000
750x1000
9918223
LC 150/700-E-C2-FAN
1x21...50W
0,165
20
1000
750x1000
9918224
LC 148/1050-E-C2-FAN
1x21...48W
0,165
20
1000
750x1000
9918225
LC 142/1400-E-C2-FAN 1x21..40W 220-240
0,164
20
1000
750x1000
9918232
DLC 116/350-A
1x16W 220-240V
0,097
25/150
3000
800x1000
9918233
DLC 116/500-A
1x16W 220-240V
0,097
25/150
3000
800x1000
9918236
DLC 116/700-A
1x16W 220-240V
0,097
25/150
3000
800x1000
9918247
DLC 120/1050-A
1x20W 220-240V
0,097
25/150
3000
800x1000
1x42W 220-240V
1x90W 220-240V
0,243
24
1512
750x1000
0,236
24
1512
750x1000
0,230
16
1456
750x1000
0,250
16
1456
750x1000
0,250
16
1456
750x1000
0,250
16
1456
750x1000
9918252
DLC 125/350-A
1x25W 220-240V
0,097
25/150
3000
800x1000
9918253
DLC 125/500-A
1x25W 220-240V
0,097
25/150
3000
800x1000
9918256
DLC 125/700-A
1x25W 220-240V
0,097
25/150
3000
800x1000
www.elt.es
289
Packaging, unit net weight and pallet conditioning of ELT products
Embalaje, peso unitario neto y acondicionamiento por palet de
productos ELT
Model
Ref. No.
Modelo
Net unit
weight
Units per
box
Units per
pallet
Pallet
dimension
Units per
pallet
Pallet
dimension
Peso neto
unitario
Unidades
por caja
Unidades
por palet
Dimensiones
del palet
Unidades
por palet
Dimensiones
del palet
9918261
LC 125/350-A-UN
1x25W 110-277V
0,100
25/150
3000
800x1000
9918262
LC 125/500-A-UN
1x25W 110-277V
0,100
25/150
3000
800x1000
9918263
LC 125/700-A-UN
1x25W 110-277V
0,100
25/150
3000
800x1000
9918271
LC 150/350-E-UN 1x23..50W 110-277V
0,123
30
1680
750x1000
9918272
LC 150/500-E-UN 1x23..50W 110-277V
0,123
30
1680
750x1000
9918273
LC 150/700-E-UN 1x24..50W 110-277V
0,123
30
1680
750x1000
9918274
LC 148/1050-E-UN 1x23..48W 110-277V
0,123
30
1680
750x1000
9918275
LC 142/1400-E-UN 1x18..42W 110-277V
0,123
30
1680
750x1000
9918281
LC 150/350-E-C2-UN 23..50W 110-277V
0,164
20
1000
750x1000
9918282
LC 150/500-E-C2-UN 23..50W 110-277V
0,164
20
1000
750x1000
9918283
LC 150/700-E-C2-UN 24..50W 110-277V
0,164
20
1000
750x1000
9918284
LC 148/1050-E-C2-UN 23..48W 110-277
0,164
20
1000
750x1000
9918285
LC 142/1400-E-C2-UN 18..42W 110-277
0,164
20
1000
750x1000
9918291
LC 150/350-E-VDR
1x23...50W
0,123
30
1680
750x1000
9918292
LC 150/500-E-VDR
1x23...50W
0,123
30
1680
750x1000
9918293
LC 150/700-E-VDR
1x24...50W
0,131
30
1680
750x1000
9918294
LC 148/1050-E-VDR
1x23...48W
0,123
30
1680
750x1000
9918295
LC 142/1400-E-VDR
1x18...42W
0,123
30
1680
750x1000
9926010
LC 225/350-EN 2x25W 110-240V IP67
0,684
10
560
750x1000
630
800X1200
9926020
LC 225/500-EN 2x25W 110-240V IP67
0,680
10
560
750x1000
630
800X1200
9926030
LC 225/700-EN 2x25W 110-240V IP67
0,676
10
560
750x1000
630
800X1200
9926011
LC 225/350-EN-2 2x25W 220-240V IP67
0,700
10
560
750x1000
630
800X1200
9926021
LC 225/500-EN-2 2x25W 220-240V IP67
0,700
10
560
750x1000
630
800X1200
9926031
LC 225/700-EN-2 2x25W 110-240V IP67
0,700
10
800
750x1000
9950501
eLED LINE 1 800 840
0,022
80
5120
750x1000
9950502
eLED LINE 1 800 830
0,022
80
5120
750x1000
9950503
eLED LINE 1 800 857
0,022
80
5120
750x1000
9950508
eLED LINE 1 1100 830
0,037
40
2560
750x1000
9950509
eLED LINE 1 1100 840
0,037
40
2560
750x1000
9950510
eLED LINE 1 1100 857
0,037
40
2560
750x1000
9950521
eLED LINE 2 1350 830
0,043
60
1260
750x1000
9950522
eLED LINE 2 1350 840
0,043
60
1260
750x1000
9950523
eLED LINE 2 1350 857
0,043
60
1260
750x1000
9950526
eLED LINE 2 2100 830
0,073
40
840
750x1000
9950527
eLED LINE 2 2100 840
0,073
40
840
750x1000
9950528
eLED LINE 2 2100 857
0,073
40
840
750x1000
9950541
eLED SQUARE 2 1700 830
0,165
30
450
750x1000
9950542
eLED SQUARE 2 1700 840
0,165
30
450
750x1000
9950543
eLED SQUARE 2 1700 857
0,165
30
450
750x1000
9950551
eLED OCTO 1 1850 830
0,064
30
720
750x1000
9950552
eLED OCTO 1 1850 840
0,064
30
720
750x1000
9950553
eLED OCTO 1 1850 857
0,064
30
720
750x1000
9950556
eLED OCTO 1 2250 830
0,064
30
720
750x1000
9950557
eLED OCTO 1 2250 840
0,064
30
720
750x1000
9950558
eLED OCTO 1 2250 857
0,064
30
720
750x1000
9954001
eDIM 100
1...100W 230V 50-60Hz
0,045
1
9954002
eDIM 440
1...440W 230V 50-60Hz
0,045
1
Data into this catalogue are subject to change without prior notice
for the purpose of improvement or discontinued products. We kindly
TGSWGUV[QWVQCUMVJGNCVGUVURGEKſECVKQPUCPFEJGEMVJGEQPVGPVUKP
the moment of placing an order.
Los datos de este catálogo están sujeto a cambios sin previo aviso
por cuestiones de mejora o de descatalogación de producto. Les
rogamos se aseguren de utilizar la documentación más actualizada y
revisar sus contenidos en el momento de realizar pedidos.
290
www.elt.es
Commercial Network
Red comercial
SPAIN BRANCHES
DELEGACIONES ESPAÑA
ALICANTE
Dª JOSEFINA CANET GARCÍA
Fco. Montero Pérez, 17,
03009 ALICANTE
Tel. 965 243 143
Fax 965 656 861
e-mail: [email protected]
CANARIAS
GONZÁLEZ ESCUDERO, S.A.L.
D. Pedro González Escudero
38004 SANTA CRUZ DE TENERIFE
Tel. 922 311 638
Fax 922 311 638
e-mail: [email protected]
JAÉN
INSEL ENERGY, S.L.
D. José Ballesta Ramos
Pol. Los Olivares, Huelma, 9-10
23009 JAÉN
Tel. 953 280 677
Fax 953 280 537
e-mail: [email protected]
ANDALUCÍA OCCIDENTAL
RUEDA REPRESENTACIONES
TECNOLÓGICAS, S.L.
+PFWUVTKC2NVC'FKſEKQ/GVTQRQN
41927 MAIRENA DEL ALJARAFE (SEVILLA)
Tel. 955 601 000
Fax 955 087 478
e-mail: [email protected]
CASTILLA- LA MANCHA
PROCAIN-MAN, S.L.
Ánimas, 17
13300 VALDEPEÑAS
Tel. 926 320 826
Fax 926 322 716
e-mail:
[email protected]
LA RIOJA-NAVARRA
D. JAIME RICKETTS URBAN
Móvil: 619 145 979
e-mail: [email protected]
1ſEKPCUEGPVTCNGU'.6
50016 ZARAGOZA
Tel. 902 519 666
Fax 902 519 777
ANDALUCÍA ORIENTAL
E.J.D., S.A.
Cuevas Bajas, 29
29004 MÁLAGA
Tel. 952 230 415
Fax 952 230 416
e-mail: [email protected]
CASTILLA-LEÓN
D. PABLO RODRÍGUEZ GABILONDO
47001 VALLADOLID
Móvil: 627 576 876
Tel. 983 307 159
Fax 983 308 436
e-mail: [email protected]
MADRID
D. ALFREDO MARTÍN VICENTE
28100 ALCOBENDAS
Tel. 610 529 086
Fax 91 662 11 11
e-mail: [email protected]
ARAGÓN
D. JAIME RICKETTS URBAN
Móvil: 619 145 979
e-mail: [email protected]
1ſEKPCUEGPVTCNGU'.6
50016 ZARAGOZA
Tel. 902 519 666
Fax 902 519 777
CATALUÑA
D. MARIO RUIZ DONAIRE
Ávila, 69
08005 BARCELONA
Tel. 933 004 450
Fax 934 854 442
e-mail: [email protected]
[email protected]
MURCIA
ELECTROREPRESENTACIONES
RUIZ-MANZANO
Guerreros, 12, 3ºC
30007 MURCIA
Tel. 968 244 046
Móvil 629 801 233
e-mail: [email protected]
ASTURIAS-CANTABRIA
D. JOSÉ ÁNGEL CUERVO GARCÍA
33011 OVIEDO
Tel. 985 119 272
Fax 985 119 272
e-mail: [email protected]
GALICIA
MAFER GALICIA S.L.
D. Iago Carrera.
36280, Vigo, PONTEVEDRA
Mov. 687 721 368
Fax. 986 366 699
e-mail: [email protected]
VALENCIA- CASTELLÓN
LOYMAR
D. Javier López - D. Juan Martínez
Isla Cabrera, 6
46026 VALENCIA
Tel. 963 332 440
Fax 963 332 527
e-mail: [email protected]
BALEARES
LIGHT BALEAR, S.L.
D. Carlos Corbacho
D’Asival, 15 - Nave 2, Pol. Ind. Can Valero
07011 PALMA DE MALLORCA
Tel. 971 761 656
Fax 971 761 167
e-mail: [email protected]
GUIPÚZCOA-VIZCAYA
D. JOSÉ Mª BENAVENTE GARASA
20009 SAN SEBASTIÁN
Tel. 943 217 095
Fax 943 310 417
e-mail: [email protected]
For further areas please contact our Zaragoza headquarters
2CTCQVTCU\QPCURQTHCXQTEQPVCEVGEQPNCUQſEKPCUEGPVTCNGUFG<CTCIQ\C
ELT
Pol. Ind. Malpica
C/E nº 11
50016 ZARAGOZA
Tel. 902 519 666
Fax 902 519 777
e-mail: [email protected]
www.elt.es
www.elt-blog.com
292
www.elt.es
Index of product name
Índice de producto
Ref.
No.
Model
Modelo
Pag.
Ref.
No.
Model
Modelo
Pag.
Ref.
No.
Model
Modelo
Pag.
9513041
4,8 V 1,8 Ah NiCd
138
1111801
AC1 13/24-SP
132
3210112
AVS-100-D (Bornes)
9513051
4,8 V 4,5 Ah NiCd
138
1112670
AC1 15/22-SC-2
133
3210113
AVS-100-D (Cables)
224
1112680
AC1 2/22-SC-2
133
1112740
AC1 15/22-SC-2
133
3210111
AVS-100-DP (Cables)
224
1112750
AC1 2/22-SC-2
133
1116340
AC1 15/22-SC-26
134
3210442
AVS-100-DP (Bornes)
224
1116350
AC1 2/22-SC-26
134
1116410
AC1 15/22-SC-26
134
3211053
AVS-100-DP-40 (Cables)
224
1116400
AC1 2/22-SC-26
134
1112530
AC1 15/23-SC
135
3211054
AVS-100-DP-40 (Bornes)
224
1113050
AC1 2/23-B2-SC
131
1112600
AC1 15/23-SC
135
3210232
AVS-400-D
223
1113055
AC1 2/23-B2-SC
131
1112890
AC1 15/24-SC
136
3210233
AVS-400-DP
223
1112860
AC1 2/23-BP-SC
135
1112891
AC1 15/24-SC
136
9616166
BE 1100-EN-HPS-SMI2
175
1113046
AC1 2/24-B2-SC
136
1111160
AC1 16/22-SP-2
129
9616165
BE 1100-EN-MH
174/177
1113057
AC1 2/24-B2-SC
132
1111760
AC1 16/22-SP-2
129
9616162
BE 1100-EN-MH-SMI
175/178
1112700
AC1 3/22-SC-2
133
1116090
AC1 16/22-SP-2
130
9616169
BE 1100-EN-MH-SMI2
178
1112770
AC1 3/22-SC-2
133
1111730
AC1 16/23-SP
131
9313064
BE 1100-MH-5 c/t
172
1116370
AC1 3/22-SC-26
134
1111731
AC1 16/23-SP
131
9313054
BE 1100-MH-5 s/t
171
1116420
AC1 3/22-SC-26
134
1111890
AC1 16/24-SP
132
9610030
BE 114-35-T5-S
107
1112560
AC1 3/23-SC
135
1116155
AC1 18/22-D-SC-6
130
9610036
BE 114-35-T5-S-UN
108
1112920
AC1 3/24-SC
136
1116158
AC1 18/22-D-SC-6
130
9616172
BE 1140-EN-MH-SMI
178
1112923
AC1 3/24-SC
136
1111632
AC1 18/23-D-SC-1
131
9616106
BE 1150-EN-HPS-SMI2
175
1112720
AC1 4/22-SC-2
133
1111633
AC1 18/23-D-SC-1
131
9616105
BE 1150-EN-MH
174/177
1112790
AC1 4/22-SC-2
133
1111623
AC1 18/24-D-SC-1
132
9616102
BE 1150-EN-MH-SMI
175/178
1116390
AC1 4/22-SC-26
134
1112690
AC1 25/22-SC-2
133
9616109
BE 1150-EN-MH-SMI2
178
1116460
AC1 4/22-SC-26
134
1116360
AC1 25/22-SC-26
134
9313022
BE 1150-MH
209
1113060
AC1 4/23-B2-SC
135
1112550
AC1 25/23-SC
135
9313065
BE 1150-MH-5 c/t
172
1113065
AC1 4/23-B2-SC
135
1112620
AC1 25/23-SC
135
9313055
BE 1150-MH-5 s/t
171
1112870
AC1 4/23-BP-SC
135
1112910
AC1 25/24-SC
136
9610141
BE 118-4-UN
102
1112493
AC1 4/24-B2-SC
132
1113106
AC1 26/22-SC
129
9616010
BE 118-EN
122
1113069
AC1 4/24-B2-SC
136
1113107
AC1 26/22-SC
129
9616011
BE 118-EN-2
122
1112950
AC1 6/22-SC
133
1113102
AC1 26/23-SC
131
9616012
BE 118-EN-3
122
1112952
AC1 6/22-SC
133
1113103
AC1 26/23-SC
131
9313060
BE 120-MH-5 c/t
172
1113072
AC1 6/23-B2-SC
135
1113101
AC1 26/24-SC
132
9313050
BE 120-MH-5 s/t
171
1113073
AC1 6/23-B2-SC
135
1113104
AC1 26/24-SC
132
9610031
BE 124-T5-S
107
1113078
AC1 6/24-B2-SC
136
1112710
AC1 32/22-SC-2
133
9610037
BE 124-T5-S-UN
108
1113079
AC1 6/24-B2-SC
136
1112780
AC1 32/22-SC-2
133
9313061
BE 135-MH-5 c/t
172
1111310
AC1 04/22 SP-2
129
1116380
AC1 32/22-SC-26
134
9313051
BE 135-MH-5 s/t
171
1116250
AC1 04/22-SP-2
130
1116381
AC1 32/22-SC-26
134
9610111
BE 136-2
100
1116252
AC1 04/22-SP-2
130
1112572
AC1 32/23-B2-SC
135
9610150
BE 136-3
101
1111470
AC1 04/23-SP
131
1112573
AC1 32/23-B2-SC
135
9610180
BE 136-4-UN
102
1111471
AC1 04/23-SP
131
1112931
AC1 32/24-B2-SC
136
9616020
BE 136-EN
122
1111780
AC1 04/24-SP
132
1120010
AC2 2/23-B1-SC-3
135
9616021
BE 136-EN-2
122
1111010
AC1 09/22-SP-2
129
1120011
AC2 2/23-B1-SC-3
135
9616022
BE 136-EN-3
122
1111360
AC1 09/22-SP-2
129
3110010
AF1 001 200V..
137
9610032
BE 139-T5-S
107
1116140
AC1 09/22-SP-2
130
3110050
AF1-003 110V..
137
9610038
BE 139-T5-S-UN
108
1116900
AC1 09/22-SP-2
130
3110030
AF1-0032 110V..
137
9616112
BE 145-EN-MH-SMI
178
1111650
AC1 09/23-SP
131
3110040
AF1-004 13W.
137
9610033
BE 149-T5-S
107
1111652
AC1 09/23-SP
131
3110060
AF1-005 200V..
137
9616125
BE 150-EN-HPS-SMI2
1111790
AC1 09/24-SP
132
3110070
AF1-006 110V..
137
9616123
BE 150-EN-MH
1111140
AC1 13/22-SP-2
129
3210212
AH 1000
227
9616122
BE 150-EN-MH-SMI
175
1111370
AC1 13/22-SP-2
129
3210251
AH 2000/220
229
9616126
BE 150-EN-MH-SMI2
178
1116780
AC1 13/22-SP-2
130
3210131
AH-002-D (Bornes)
225
9313062
BE 150-MH-5 c/t
172
1116990
AC1 13/22-SP-2
130
3210132
AH-002-D (Cables)
225
9313052
BE 150-MH-5 s/t
171
1111670
AC1 13/23-SP
131
3210191
AH-005/380-DP
226
9610034
BE 154-T5-S
107
1111671
AC1 13/23-SP
131
3210211
AVS 1000 VSyHM
227
9610013
BE 158-2
100
1111800
AC1 13/24-SP
132
3210241
AVS 2000/380
228
9610160
BE 158-3
101
294
224
175
174/177
www.elt.es
Index of product name
Índice de producto
Model
Ref.
No.
Modelo
Pag.
Ref.
No.
Model
Modelo
Pag.
Ref.
No.
Model
Modelo
Pag.
9610161
BE 158-4-UN
102
9626032
BE 258-EN-3
122
9901250
COND 30uF 440V
230
9616030
BE 158-EN
122
9620060
BE 275-UV
113
9900027
COND 32uF 250V
230
9616031
BE 158-EN-2
122
9620061
BE 275-UV-LED
113
9900028
COND 36uF 250V
230
9616032
BE 158-EN-3
122
9620016
BE 280-T5
111
9900802
COND 4,5uF 250V
230
9610250
BE 158-UN-277V
104
9630008
BE 324-T5-2
112
9900029
COND 40uF 250V
230
9616132
BE 160-EN-MH-SMI
178
9640005
BE 414-T5-2
109
9901627
COND 45uF 440V
230
9616147
BE 170-EN-HPS-SMI2
175
9640021
BE 414-T5-4-UN
110
9900030
COND 45uF 250V
230
9616145
BE 170-EN-MH
174/177
9640011
BE 418-2
105
9900804
COND 5,5uF 250V
230
9616142
BE 170-EN-MH-SMI
175/178
9640017
BE 418-4-UN
103
9901613
COND 5,7uF 420V
230
9616148
BE 170-EN-MH-SMI2
178
9640009
BE 424-T5-2
112
9900031
COND 50uF 250V
230
9313063
BE 170-MH-5 c/t
172
9640008
BE 436-2
106
9900805
COND 7uF 250V
230
9313053
BE 170-MH-5 s/t
171
9410020
CE1 4/01
123
9900002
COND. 2uF 250V
230
9610132
BE 180-T5-2
114
9410030
CE1 4/02. 26V.
123
9616167
DBE 1100-EN-MH
180/181
9610035
BE 180-T5-S
107
9410040
CE1 4/04. 48V.
123
9614062
DBE 114/24-DALI
116
9616152
BE 190-EN-MH-SMI
178
9410050
CE1 4/07. 72V.
123
9616174
DBE 1140-EN-MH
181
9621160
BE 213-TC-4-UN s/tap
98
9410060
CE1 4/11. 110V.
123
9616107
DBE 1150-EN-MH
180/181
9621170
BE 213-TC-4-UN-C2
99
9900004
COND 2,5uF 250V
230
9614072
DBE 118/57-TC-DALI
119
9621180
BE 213-TC-5 s/tapa
96
9900812
COND 2uF 250V
230
9614063
DBE 118-DALI
116
9621190
BE 213-TC-5-C2
97
9900008
COND 4,5uF 250V
230
9614065
DBE 121/39-DALI
116
9620073
BE 214-21-T5-S-UN
108
9900007
COND 4uF 250V
230
9614066
DBE 128/54-DALI
116
9621200
BE 214-28-T5-2
114
9900814
COND 4uF 250V
230
9614061
DBE 135/49/80-DALI
116
9620109
BE 214-28-UN-277V
104
9900010
COND 5,5uF 250V
230
9614064
DBE 136-DALI
116
9620070
BE 214-35-T5-S
107
9900009
COND 5uF 250V
230
9616114
DBE 145-EN-MH
181
9621011
BE 218-4-UN
103
9900803
COND 5uF 250V
230
9616124
DBE 150-EN-MH
180/181
9626010
BE 218-EN
122
9900815
COND 6uF 250V
230
9614067
DBE 158-DALI
9626011
BE 218-EN-2
122
9900011
COND 6uF250V
230
9616134
DBE 160-EN-MH
181
9626013
BE 218-EN-3
122
9900012
COND 7uF 250V
230
9616146
DBE 170-EN-MH
180/181
9621161
BE 218-TC-4-UN s/tap
98
9900816
COND 8uF 250V
230
9616154
DBE 190-EN-MH
181
9621171
BE 218-TC-4-UN-C2
99
9900013
COND 8uF250V
230
9624062
DBE 214/24-DALI
117
9621181
BE 218-TC-5 s/tapa
96
9900014
COND 9uF 250V
230
9624072
DBE 218/42-TC-DALI
119
9621191
BE 218-TC-5-C2
97
9900806
COND 9uF 250V
230
9624063
DBE 218-DALI
117
9620071
BE 224-T5-S
107
9900015
COND 10uF 250V
230
9624065
DBE 221/39-DALI
117
9621162
BE 226-TC-4-UN s/tap
98
9900807
COND 10uF 250V
230
9624066
DBE 228/54-DALI
117
9621172
BE 226-TC-4-UN-C2
99
9900016
COND 11uF 250V
230
9624061
DBE 235/49/80-DALI
117
9621182
BE 226-TC-5 s/tapa
96
9900817
COND 11uF 250V
230
9624060
DBE 235/49-DALI
117
9621192
BE 226-TC-5-C2
97
9900017
COND 12uF 250V
230
9624064
DBE 236-DALI
117
9620032
BE 232-4-UN
103
9900818
COND 12uF+-10% 250V
230
9624067
DBE 258-DALI
117
9620014
BE 236-2
100/114
9900819
COND 13uF 250V
230
9634062
DBE 314/24-DALI
118
9621020
BE 236-3
101
9900018
COND 13uF250V
230
9634063
DBE 318-DALI
118
9621021
BE 236-4-UN
103
9900019
COND 14uF 250V
230
9644062
DBE 414/24-DALI
118
9626020
BE 236-EN
122
9900808
COND 14uF 250V
230
9644063
DBE 418-DALI
118
9626021
BE 236-EN-2
122
9900020
COND 16uF 250V
230
9614030
DBE-114-35
115
9626022
BE 236-EN-3
122
9900809
COND 16uF 250V
230
9614040
DBE-118-40
115
9620110
BE 236-UN-277V
104
9900021
COND 18uF 250V
230
9614050
DBE-154-58
115
9620072
BE 239-T5-S
107
9900810
COND 18uF 250V
230
9624030
DBE-214-35
115
9621183
BE 242-TC-5 s/tapa
96
9900813
COND 2,5uF 250V
230
9624040
DBE-218-40
115
9621193
BE 242-TC-5-C2
97
9900811
COND 20uF 250V
230
9624050
DBE-254-58
115
9620008
BE 249-T5
111
9900022
COND 20uF250V
230
9918035
DLC 108/200-B
10
9620009
BE 254-T5
111
9900023
COND 22uF 250V
230
9918034
DLC 109/1050-B
10
9620013
BE 258-2
100/114
9900024
COND 25uF 250V
230
9916084
DLC 109/1050-EN
24
9621030
BE 258-3
101
9900025
COND 28uF 250V
230
9918031
DLC 110/350-B
10
9626030
BE 258-EN
122
9901607
COND 3,6uF 420V.
230
9916081
DLC 110/350-EN
24
9626031
BE 258-EN-2
122
9900026
COND 30uF 250V
230
9918032
DLC 110/500-B
10
www.elt.es
295
116
Index of product name
Índice de producto
Ref.
No.
Model
Modelo
Pag.
Ref.
No.
Model
Modelo
Pag.
Ref.
No.
Model
Modelo
Pag.
9916082
DLC 110/500-EN
24
9918029
LC 101/060-B
10
9918171
LC 150/350-E
16
9918033
DLC 110/700-B
10
9918026
LC 102/350-B
10
9918181
LC 150/350-E-C2
18
9916083
DLC 110/700-EN
24
9918027
LC 103/500-B
10
9918221
LC 150/350-E-C2-FAN
18
9918036
DLC 111/300-B
10
9918028
LC 104/700-B
10
9918281
LC 150/350-E-C2-UN
19
9918232
DLC 116/350-A
13
9918024
LC 109/1050-B
10
9918211
LC 150/350-E-FAN
16
9918233
DLC 116/500-A
13
9916024
LC 109/1050-EN
24
9918271
LC 150/350-E-UN
17
9918236
DLC 116/700-A
13
9918021
LC 110/350-B
10
9918291
LC 150/350-E-VDR
27
9918247
DLC 120/1050-A
13
9916021
LC 110/350-EN
24
9918105
LC 150/500-D
20
9918252
DLC 125/350-A
13
9918022
LC 110/500-B
10
9918125
LC 150/500-D-UN
21
9918253
DLC 125/500-A
13
9916022
LC 110/500-EN
24
9918172
LC 150/500-E
16
9918256
DLC 125/700-A
13
9918023
LC 110/700-B
10
9918182
LC 150/500-E-C2
18
9918137
DLC 150/700-D-DALI
22
9916023
LC 110/700-EN
24
9918222
LC 150/500-E-C2-FAN
18
9918147
DLC 190/700-D-DALI
22
9916113
LC 1150/700-XT
28
9918212
LC 150/500-E-FAN
16
9954001
eDIM 100
91
9918010
LC 116/350-A
11
9918282
LC 150/500-E-C2-UN
19
9954002
eDIM 440
91
9916000
LC 116/350-EN-2
25
9918272
LC 150/500-E-UN
17
9950508
eLED LINE 1 1100 830
32
9918011
LC 116/500-A
11
9918292
LC 150/500-E-VDR
27
9950509
eLED LINE 1 1100 840
32
9916001
LC 116/500-EN-2
25
9918107
LC 150/700-D
20
9950510
eLED LINE 1 1100 857
32
9918012
LC 116/700-A
11
9918127
LC 150/700-D-UN
21
9950502
eLED LINE 1 800 830
29
9916002
LC 116/700-EN-2
25
9918173
LC 150/700-E
16
9950501
eLED LINE 1 800 840
29
9918009
LC 125/300-A
11
9918183
LC 150/700-E-C2
18
9950503
eLED LINE 1 800 857
29
9918015
LC 125/350-A
11
9918223
LC 150/700-E-C2-FAN
18
9950521
eLED LINE 2 1350 830
35
9918261
LC 125/350-A-UN
12
9918283
LC 150/700-E-C2-UN
19
9950522
eLED LINE 2 1350 840
35
9916010
LC 125/350-EN-2
25
9918213
LC 150/700-E-FAN
16
9950523
eLED LINE 2 1350 857
35
9918016
LC 125/500-A
11
9918273
LC 150/700-E-UN
17
9950526
eLED LINE 2 2100 830
38
9918262
LC 125/500-A-UN
12
9918293
LC 150/700-E-VDR
27
9950527
eLED LINE 2 2100 840
38
9916011
LC 125/500-EN-2
25
9918041
LC 152/1050-C
14
9950528
eLED LINE 2 2100 857
38
9918014
LC 125/600-A
11
9918045
LC 152/600-C
14
9950551
eLED OCTO 1 1850 830
42
9918018
LC 125/640-A
11
9918080
LC 152/600-C-UN
15
9950552
eLED OCTO 1 1850 840
42
9918019
LC 125/700-A
11
9918081
LC 152/650-C-UN
15
9950553
eLED OCTO 1 1850 857
42
9918263
LC 125/700-A-UN
12
9918082
LC 152/700-C-UN
15
9950556
eLED OCTO 1 2250 830
45
9916012
LC 125/700-EN-2
25
9918046
LC 156/650-C
14
9950557
eLED OCTO 1 2250 840
45
9918175
LC 142/1400-E
16
9918040
LC 160/700-C
14
9950558
eLED OCTO 1 2250 857
45
9918185
LC 142/1400-E-C2
18
9916104
LC 190/1050-XT
28
9950541
eLED SQUARE 2 1700 830
48
9918225
LC 142/1400-E-C2-FAN
18
9916101
LC 190/350-XT
28
9950542
eLED SQUARE 2 1700 840
48
9918285
LC 142/1400-E-C2-UN
19
9916102
LC 190/500-XT
28
9950543
eLED SQUARE 2 1700 857
48
9918215
LC 142/1400-E-FAN
16
9918117
LC 190/700-D
20
9907103
FAV 15/12-B
62
9918275
LC 142/1400-E-UN
17
9916103
LC 190/700-XT
28
9907123
FAV 15/24-B
62
9918295
LC 142/1400-E-VDR
27
9926010
LC 225/350-EN
26
9907104
FAV 20/12-B
62
9918042
LC 142/600-C
14
9926020
LC 225/500-EN
26
9907105
FAV 30/12-B
62
9918043
LC 142/650-C
14
9926030
LC 225/700-EN
26
9907124
FAV 20/24-B
62
9918044
LC 142/700-C
14
9926011
LC 225/350-EN-2
26
9907125
FAV 30/24-B
62
9918102
LC 142/700-D
20
9926021
LC 225/500-EN-2
26
9907107
FAV 50/12-B
62
9918109
LC 148/1050-D
20
9926031
LC 225/700-EN-2
26
9907108
FAV 75/12-B
62
9918123
LC 148/1050-D-UN
21
9918200
LTC 5/23-LED
61
9907127
FAV 50/24-B
62
9918174
LC 148/1050-E
16
9810010
TCE 5/23-E
257
9907128
FAV 75/24-B
62
9918184
LC 148/1050-E-C2
18
9813030
TCE 6/23-E
257
9907149
FAV 100/12-B-EN
63
9918224
LC 148/1050-E-C2-FAN
18
9813040
TCE 7/23-E
257
9907151
FAV 200/12-B-EN
63
9918284
LC 148/1050-E-C2-UN
19
9813050
TCE 10/23-E
257
9907169
FAV 100/24-B-EN
63
9918214
LC 148/1050-E-FAN
16
8224591
TR 105/23-01-B
258
9907171
FAV 200/24-B-EN
63
9918274
LC 148/1050-E-UN
17
8224725
TR 5/22-01-SC
258
9513050
FES 6-80 / 4D / 180
138
9918294
LC 148/1050-E-VDR
27
8224700
TR 5/23-01-SC
258
9513040
FES 6-80 / 4SC / 60
138
9918103
LC 150/350-D
20
6210749
VHE 3/23-C2-ADP-P
220
3512001
ITP 277-8KA
90
9918123
LC 150/350-D-UN
21
6210743
VHE 3/23-C2-AI-AF
219
296
www.elt.es
Index of product name
Índice de producto
Ref.
No.
Model
Modelo
Pag.
Ref.
No.
Model
Modelo
Pag.
Ref.
No.
Model
Modelo
Pag.
6210153
VHE 7/23-C2-AI-P 2Mang.
220
5210300
VME 12/23-C2-AF
188
5114530
VMI 40/23-2P-RME-A
189
6210327
VHE 100/23-002-AF
221
5110370
VME 25/22-EA
214
5114531
VMI 40/23-2P-RME-SM
189
6210321
VHE 100/23-3-1000-AF
221
5218160
VME 25/23-2P-C2-AF
190
5112424
VMI 40/23-3
6210306
VHE 200/23-002-AF
221
5218161
VME 25/23-2P-C2-AF-SM
190
5112425
VMI 40/23-3-P
209
6210302
VHE 200/38-40-005-AF
221
5210270
VME 25/23-C2-AF
188
5211570
VMI 40/23-C2
187
6210303
VHE 200/38-40-3 AF S/
ARR
221
5110390
VME 25/23-EA
214
5211580
VMI 40/23-C2S-AF
VME 40/22-EA
214
5112200
VMI 40/23-SC
186/212
6210300
VHE 200/38-40-4-AF S/
ARR
5110380
221
5218170
VME 40/23-2P-C2-AF
190
5112203
VMI 40/23-SC-P
186/212
6210304
VHE 200/38-40-4-AF-2000
221
5218171
VME 40/23-2P-C2-AF-SM
190
5112260
VMI 40/24-2
184/210
6210305
VHE 200/38-40-5 AF S/AR
221
5210280
VME 40/23-C2-AF
188
5112261
VMI 40/24-2-P
210
6210292
VHE 200/38-40-5-AF-2000
221
5110400
VME 40/23-EA
214
5112201
VMI 40/24-SC
186/212
6210620
VHE 25/23-C2-AI
219
5113520
VMI 5/22-2
185
5113990
VMI 70/22-3
185
6210680
VHE 40/23-C2-AI-AF
219
5112550
VMI 5/23-2
183
5112570
VMI 70/23-3
183
6112562
VHI 3/23-3
209
5112530
VMI 5/24-2
184
5112571
VMI 70/24-3
184
6112563
VHI 3/23-3-P
209
5112120
VMI 8/22-2
182
6110193
VSE 5/22-3T-D
196
6212740
VHI 3/23-ARCE-150
216
5113530
VMI 8/22-2
185
6210753
VSE 60/23-1000-AF
200
6212651
VHI 3/23-C2-AI
217
5112430
VMI 8/23-2
183
6210751
VSE 60/23-100-AF
6112572
VHI 3/24-3
210
5114500
VMI 8/23-2P-RME-A
189
6110340
VSE 7/22-3T-D
196/214
6112573
VHI 3/24-3-P
210
5114501
VMI 8/23-2P-RME-SM
189
6110330
VSE 7/22-3T-E
196/214
6112047
VHI 7/22-3T-D
209
5211510
VMI 8/23-C2
187
6218251
VSE 7/23-2P-C2-AF
205
6112049
VHI 7/22-3T-D-P
209
5211520
VMI 8/23-C2S
187
6218200
VSE 7/23-2P-C2-AF s/Arr
205
6113675
VHI 7/22-3T-E6
211
5112450
VMI 8/24-2
184
6218250
VSE 7/23-2P-C2-AF-SM
205
6112622
VHI 7/22-3T-G
210
5113980
VMI 100/22-4
185
6210310
VSE 7/23-C2-AI-AF
207/219
6112623
VHI 7/22-3T-G-P
210
5112581
VMI 100/22-5
182
6110170
VSE 10/22-EA
196/214
6211536
VHI 7/23-C2-SC-PCLEMA
218
5112580
VMI 100/23-4
183
6110173
VSE 10/22-3T-B
196/214
6112262
VHI 100/23-3
213
5112342
VMI 100/24-4
184
6218210
VSE 10/23-2P-C2-AF
205
6112265
VHI 100/23-4
213
5112300
VMI 12/22-3
182
6218211
VSE 10/23-2P-C2-AF-SM
205
6112748
VHI 200/23-4
213
5113770
VMI 12/22-3
185
6210610
VSE 10/23-C2-AI-AF
6112751
VHI 200/38-40-3
213
5114510
VMI 12/23-2P-RME-A
189
6210612
VSE 10/23-C2-AI-P
207
6112752
VHI 200/38-40-4
213
5114511
VMI 12/23-2P-RME-SM
189
6210322
VSE 100/23-1000-AF
200
6112744
VHI 200/38-40-7
213
5112400
VMI 12/23-3
183
6210323
VSE 100/23-100-AF
6112302
VHI 200/40-41-8
213
5211530
VMI 12/23-C2
187
6110390
VSE 15/22-3T-D
196/214
6212787
VHI 25/23-ARCE-002
216
5211540
VMI 12/23-C2S
187
6110360
VSE 15/22-3T-E
196/214
6212783
VHI 25/23-ARCE-002-P
216
5112440
VMI 12/24-3
184
6218220
VSE 15/23-2P-C2-AF
205
6212782
VHI 25/23-ARCE-400
216
5112290
VMI 25/22-3
182/208
6218221
VSE 15/23-2P-C2-AF-SM
205
6212320
VHI 25/23-C2-AI
217
5113780
VMI 25/22-3
185/211
6210580
VSE 15/23-C2-AI-AF
6212330
VHI 25/23-C2S-AI
217
5112682
VMI 25/22-SC
186/212
6210811
VSE 15/23-C2-AI-P
6212778
VHI 25/23-SC-ARCE-002
199
5114520
VMI 25/23-2P-RME-A
189
6110400
VSE 25/22-3T-D
196/214
6212777
VHI 25/23-SC-ARCE-DP
199
5114521
VMI 25/23-2P-RME-SM
196/214
6113980
VHI 3/22-3
211
5112410
VMI 25/23-3
6212744
VHI 3/23-ARCE-100-DP
216
5612563
6212743
VHI 3/23-ARCE-100-DP-P
216
6212793
VHI 40/23-ARCE-002
216
6212830
VHI 40/23-ARCE-002-P
6212792
183/209
187
200
207/219
200
207/219
220
189
6110350
VSE 25/22-3T-E
183/209
6218230
VSE 25/23-2P-C2-AF
205
VMI 25/23-3-AF-002
215
6218231
VSE 25/23-2P-C2-AF-SM
205
5112411
VMI 25/23-3-P
209
6210590
VSE 25/23-C2-AI-AF
5211550
VMI 25/23-C2
187
6210591
VSE 25/23-C2-AI-P
207
216
5211560
VMI 25/23-C2S-AF
187
6210666
VSE 25/23-C2-AI-P.
220
VHI 40/23-ARCE-400
216
5112680
VMI 25/23-SC
186/212
6110410
VSE 40/22-3T-D
196/214
6212796
VHI 40/23-ARCE-400-P
216
5112681
VMI 25/23-SC-P
186/212
6110370
VSE 40/22-3T-E
196/214
6212340
VHI 40/23-C2-AI
217
5112250
VMI 25/24-3
184/210
6218240
VSE 40/23-2P-C2-AF
205
6212350
VHI 40/23-C2S-AI
217
5112251
VMI 25/24-3-P
210
6218241
VSE 40/23-2P-C2-AF-SM
205
5218140
VME 8/23-2P-C2-AF
190
5112683
VMI 25/24-SC
186/212
6210600
VSE 40/23-C2-AI-AF
5218190
VME 8/23-2P-C2-AF-SM
190
5112150
VMI 40/22-2
182/208
6210601
VSE 40/23-C2-AI-P
5210290
VME 8/23-C2-AF
188
5113670
VMI 40/22-26
185/211
6112410
VSI 5/22-2
191
5218150
VME 12/23-2P-C2-AF
190
5112202
VMI 40/22-SCz
186/212
6112421
VSI 5/22-3T-D
192
5218180
VME 12/23-2P-C2-AF-SM
190
6212180
VMI 40/23-2 AF-400
215
6112422
VSI 5/22-3T-D-P
192
www.elt.es
297
207/219
207/219
207
Index of product name
Índice de producto
Ref.
No.
Model
Modelo
Pag.
Ref.
No.
Model
Modelo
Pag.
Ref.
No.
Model
Modelo
Pag.
6113873
VSI 5/22-3T-E6
194
6112470
VSI 15/22-3T-D-P
192/209
6112216
VSI 25/3T-E-SC
195/212
6114653
VSI 5/23-2P-RASE-CA
201
6112330
VSI 15/22-3T-E
191/208
6112217
VSI 25/3T-G-SC
195/212
6114654
VSI 5/23-2P-RASE-SM
201
6113590
VSI 15/22-3T-E6
194/211
6112222
VSI 25/3TG-SC-P
6114655
VSI 5/23-2P-RASE-SMI
202
6112315
VSI 15/22-3T-E-P
191/208
6112360
VSI 40/22-3T-D
192/209
6212686
VSI 5/23-ARCE-100-DP
198
6111530
VSI 15/22-3T-G
193/210
6112363
VSI 40/22-3T-D-P
192/209
6112040
VSI 7/22-3T-D
192
6111570
VSI 15/22-3T-G-P
193/210
6112660
VSI 40/22-3T-E
191/208
6112044
VSI 7/22-3T-D-P
192
6114982
VSI 15/23-2P-CA-400
204
6113610
VSI 40/22-3T-E6
194/211
6112700
VSI 7/22-3T-E
191
6114912
VSI 15/23-2P-CA-400-SM
204
6112666
VSI 40/22-3T-E-P
191/208
6113920
VSI 7/22-3T-E6
194
6114681
VSI 15/23-2P-RASE-CA
201
6111550
VSI 40/22-3T-G
193/210
6112704
VSI 7/22-3T-E-P
191
6114680
VSI 15/23-2P-RASE-SM
201
6111552
VSI 40/22-3T-G-P
193/210
6111510
VSI 7/22-3T-G
193
6114595
VSI 15/23-2P-RASE-SMI
202
6212491
VSI 40/23-2-AF-100-1
197
6111560
VSI 7/22-3T-G-P
193
6114597
VSI 15/23-2P-RASE-SMI-P
203
6114692
VSI 40/23-2P-CA-400
204
6114622
VSI 7/23-2P-CA-400
204
6212620
VSI 15/23-3 AF-100-1
197
6114699
VSI 40/23-2P-CA-400-SM
204
6114619
VSI 7/23-2P-CA-400-SM
204
6212150
VSI 15/23-3 AF-150
215
6114711
VSI 40/23-2P-RASE-CA
201
6114503
VSI 7/23-2P-RASE-CA
201
6212730
VSI 15/23-ARCE-100
198
6114710
VSI 40/23-2P-RASE-SM
201
6114501
VSI 7/23-2P-RASE-SM
201
6212731
VSI 15/23-ARCE-150
198/216
6114736
VSI 40/23-2P-RASE-SMI
202
6114725
VSI 7/23-2P-RASE-SMI
202
6212732
VSI 15/23-ARCE-150-P
216
6114738
VSI 40/23-2P-RASE-SMI-P
203
6114726
VSI 7/23-2P-RASE-SMI-P
203
6212260
VSI 15/23-C2-AI
206/217
6112361
VSI 40/23-3T-D
192
6114500
VSI 7/23-2P-RME-SM
201
6212290
VSI 15/23-C2S-AI
206/217
6112366
VSI 40/23-3T-D-P
192
6114502
VSI 7/23-2P-RSE-CA
201
6212267
VSI 15/23-C2-SC-P
218
6112661
VSI 40/23-3T-E
191
6212251
VSI 7/23-3 AF
197
6212840
VSI 15/23-SC-ARCE-DP
199
6111551
VSI 40/23-3T-G
193
6212610
VSI 7/23-3 AF-100-1
197
6112491
VSI 15/3T-D-SC
195/212
6112365
VSI 40/23-3T-G-P
193
6212130
VSI 7/23-3 AF-150
215
6112490
VSI 15/3T-D-SC-P
195/212
6212790
VSI 40/23-ARCE-100
198
6212704
VSI 7/23-ARCE-100
198
6113521
VSI 15/3TE-6-SC
212
6212791
VSI 40/23-ARCE-400
6212705
VSI 7/23-ARCE-150
198/216
6113520
VSI 15/3T-E6-SC-P
212
6212280
VSI 40/23-C2-AI
206/217
6212706
VSI 7/23-ARCE-150-P
216
6113522
VSI 15/3T-EI6-SC-P
195
6212310
VSI 40/23-C2S-AI
206/217
6211510
VSI 7/23-C2-AI
206/217
6112500
VSI 15/3T-E-SC
195/212
6112401
VSI 60/3T-D
192
6211520
VSI 7/23-C2S-AI
206/217
6112501
VSI 15/3T-E-SC-P
195/212
6212802
VSI 60/3T-D-ARCE-100
198
6112140
VSI 10/22-2
191/208
6112504
VSI 15/3T-G-SC
195/212
6112402
VSI 60/3T-D-P
192
6113860
VSI 10/22-2
194/211
6112505
VSI 15/3T-G-SC-P
195/212
6112406
VSI 60/3T-E
191
6112145
VSI 10/22-2-P
191/208
6112350
VSI 25/22-3T-D
192/209
6113979
VSI 60/3T-E6
194
6112180
VSI 10/22-3T-B
192/209
6112460
VSI 25/22-3T-D-P
192/209
6112601
VSI 60/3T-E-P
191
6112182
VSI 10/22-3T-B-P
192/209
6112650
VSI 25/22-3T-E
191/208
6112403
VSI 60/3T-G
193
6111520
VSI 10/22-3T-G
193/210
6113601
VSI 25/22-3T-E6
194/211
6112407
VSI 60/3T-G-P
193
6111525
VSI 10/22-3T-G-P
193/210
6112653
VSI 25/22-3T-E-P
191/208
6211529
VSI 7/23-C2-AI CLEMA
206
6212210
VSI 10/23-2 AF-100-1
197
6111540
VSI 25/22-3T-G
193/210
6212140
VSI 10/23-2-AF-150
215
6111541
VSI 25/22-3T-G-P
193/210
6114581
VSI 10/23-2P-CA-400
204
6114561
VSI 25/23-2P-CA-400
204
6114902
VSI 10/23-2P-CA-400-SM
204
6114923
VSI 25/23-2P-CA-400-SM
204
6114671
VSI 10/23-2P-RASE-CA
201
6114701
VSI 25/23-2P-RASE-CA
201
6114670
VSI 10/23-2P-RASE-SM
201
6114700
VSI 25/23-2P-RASE-SM
201
6114665
VSI 10/23-2P-RASE-SMI
202
6114927
VSI 25/23-2P-RASE-SMI
202
6114664
VSI 10/23-2P-RASE-SMI-P
203
6114929
VSI 25/23-2P-RASE-SMI-P
203
6212713
VSI 10/23-ARCE-100
198
6212230
VSI 25/23-3 AF-100-1
197
6212714
VSI 10/23-ARCE-150
198/216
6212160
VSI 25/23-3-AF-400
215
6212715
VSI 10/23-ARCE-150-P
216
6212780
VSI 25/23-ARCE-100
198
6212520
VSI 10/23-C2-AI
206/217
6212781
VSI 25/23-ARCE-400
198/216
6212530
VSI 10/23-C2S-AI
206/217
6212784
VSI 25/23-ARCE-400-P
6112291
VSI 100/3T-D
192/213
6212270
VSI 25/23-C2-AI
206/217
6112293
VSI 100/3T-E
191
6212300
VSI 25/23-C2S-AI
206/217
6113888
VSI 100/3T-E6
194
6112215
VSI 25/3T-D-SC
195/212
6112292
VSI 100/3T-G
193
6112221
VSI 25/3T-D-SC-P
212
6112340
VSI 15/22-3T-D
192/209
6113691
VSI 25/3T-E6-SC
195/212
298
212
198
216
www.elt.es
Edita:
La Abuela Creativa S.C.
Diseño y coordinación editorial:
4CÕN/CTEQU)KOÃPG\4QDTGU
Maquetación:
Sonia Gonzalvo Giraldos
www.laabuelacreativa.com
Especialidades Luminoté cnicas, S.A.U.
Pol. Ind. Malpica - calle E nº 11 - E-50016 Za ragoza (Spain)
Tel: + 34 902 519 666 - Fax: + 34 902 519 777
E-mail: [email protected]
FP-070/09/14
www.elt.es
www.elt-blog.com